Detailed information    

insolico Bioinformatically predicted

Overview

Name   HI0659   Type   Machinery gene
Locus tag   SCR2_RS07070 Genome accession   NC_022245
Coordinates   1433668..1433964 (-) Length   98 a.a.
NCBI ID   WP_020997975.1    Uniprot ID   U2ZJ70
Organism   Streptococcus constellatus subsp. pharyngis C818     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1429236..1444812 1433668..1433964 within 0


Gene organization within MGE regions


Location: 1429236..1444812
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SCR2_RS07055 (SCR2_1386) recR 1429236..1429832 (-) 597 WP_006268506.1 recombination mediator RecR -
  SCR2_RS07060 (SCR2_1387) pbp2b 1429843..1431903 (-) 2061 WP_020997973.1 penicillin-binding protein PBP2B -
  SCR2_RS10480 - 1432267..1432434 (-) 168 WP_006268192.1 hypothetical protein -
  SCR2_RS07065 (SCR2_1388) - 1432441..1433646 (-) 1206 WP_020997974.1 hypothetical protein -
  SCR2_RS07070 (SCR2_1389) HI0659 1433668..1433964 (-) 297 WP_020997975.1 helix-turn-helix domain-containing protein Machinery gene
  SCR2_RS07075 (SCR2_1390) - 1433954..1434319 (-) 366 WP_006268450.1 type II toxin-antitoxin system RelE/ParE family toxin -
  SCR2_RS07080 - 1434385..1434660 (-) 276 WP_006268376.1 terminase small subunit -
  SCR2_RS07085 - 1434740..1434970 (-) 231 WP_022525741.1 hypothetical protein -
  SCR2_RS07090 (SCR2_1391) - 1435209..1435619 (-) 411 WP_006268286.1 hypothetical protein -
  SCR2_RS07095 (SCR2_1392) - 1435600..1436082 (-) 483 WP_006268241.1 hypothetical protein -
  SCR2_RS09760 (SCR2_1393) - 1436101..1436481 (-) 381 WP_006268172.1 hypothetical protein -
  SCR2_RS09765 - 1436506..1436715 (-) 210 WP_006268092.1 hypothetical protein -
  SCR2_RS10485 - 1436795..1436971 (-) 177 WP_006267997.1 hypothetical protein -
  SCR2_RS07105 (SCR2_1394) - 1437291..1437782 (-) 492 WP_020997976.1 hypothetical protein -
  SCR2_RS07110 (SCR2_1395) - 1438101..1438955 (-) 855 WP_006268118.1 ATP-binding protein -
  SCR2_RS07115 (SCR2_1396) - 1438967..1439788 (-) 822 WP_006268372.1 DnaD domain protein -
  SCR2_RS07120 (SCR2_1397) - 1439781..1439975 (-) 195 WP_006268001.1 hypothetical protein -
  SCR2_RS07125 (SCR2_1398) - 1439987..1440253 (-) 267 WP_020997977.1 HTH domain-containing protein -
  SCR2_RS07130 (SCR2_1399) - 1440264..1440458 (-) 195 WP_006268448.1 hypothetical protein -
  SCR2_RS07135 (SCR2_1400) - 1440664..1440852 (-) 189 WP_006268000.1 hypothetical protein -
  SCR2_RS09770 (SCR2_1401) - 1441023..1441610 (+) 588 WP_020997978.1 helix-turn-helix domain-containing protein -
  SCR2_RS07145 - 1441756..1442919 (+) 1164 Protein_1420 tyrosine-type recombinase/integrase -
  SCR2_RS07150 (SCR2_1404) - 1443077..1443769 (-) 693 WP_003036126.1 phosphoglycerate mutase -
  SCR2_RS07155 (SCR2_1405) - 1443907..1444368 (-) 462 WP_003035860.1 Fur family transcriptional regulator -
  SCR2_RS07160 (SCR2_1406) - 1444537..1444812 (-) 276 WP_003036014.1 HU family DNA-binding protein -

Sequence

Protein


Download         Length: 98 a.a.        Molecular weight: 10755.42 Da        Isoelectric Point: 4.8898

>NTDB_id=61830 SCR2_RS07070 WP_020997975.1 1433668..1433964(-) (HI0659) [Streptococcus constellatus subsp. pharyngis C818]
MKNSAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNERGISQKKLEELSGVSQPVIARMETGKTSPQLDTVLKVL
ASLGKTLAVVPLEGEQIS

Nucleotide


Download         Length: 297 bp        

>NTDB_id=61830 SCR2_RS07070 WP_020997975.1 1433668..1433964(-) (HI0659) [Streptococcus constellatus subsp. pharyngis C818]
ATGAAAAATAGTGCAATTGGTAGTAACTGGAAAGATGTAAGAGCTGAGTTATTCAGCAAAGAAGAAATTTTAGAAAGTGA
TATGCGTGTGGCTATCATGAGTGAGCTTATCGAGGCTAGGAATGAAAGGGGTATTAGTCAGAAAAAACTAGAGGAGCTGA
GTGGTGTTAGTCAGCCAGTCATAGCTAGAATGGAGACAGGAAAAACAAGCCCACAGCTTGATACCGTTTTAAAAGTATTA
GCAAGTCTTGGTAAGACGTTGGCTGTTGTACCCTTAGAGGGCGAACAGATAAGCTAG

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(37-88)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB U2ZJ70

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  HI0659 Haemophilus influenzae Rd KW20

59.341

92.857

0.551

Multiple sequence alignment