Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   NUW85_RS09660 Genome accession   NZ_CP102603
Coordinates   2035730..2035849 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain MBLB0692     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 2030730..2040849
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NUW85_RS09635 (NUW85_09635) - 2030968..2031726 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  NUW85_RS09640 (NUW85_09640) - 2031720..2032667 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  NUW85_RS09645 (NUW85_09645) ceuB 2032657..2033610 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  NUW85_RS09650 (NUW85_09650) - 2034025..2035389 (+) 1365 WP_014304341.1 aspartate kinase -
  NUW85_RS09655 (NUW85_09655) - 2035484..2035579 (+) 96 WP_012116800.1 YjcZ family sporulation protein -
  NUW85_RS09660 (NUW85_09660) phrC 2035730..2035849 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  NUW85_RS09665 (NUW85_09665) rapC 2035833..2036981 (-) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  NUW85_RS09670 (NUW85_09670) - 2037134..2038567 (-) 1434 WP_161620115.1 HAMP domain-containing sensor histidine kinase -
  NUW85_RS09675 (NUW85_09675) - 2038554..2039237 (-) 684 WP_024084885.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=617433 NUW85_RS09660 WP_003156334.1 2035730..2035849(-) (phrC) [Bacillus amyloliquefaciens strain MBLB0692]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=617433 NUW85_RS09660 WP_003156334.1 2035730..2035849(-) (phrC) [Bacillus amyloliquefaciens strain MBLB0692]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718