Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   LIS75_RS01965 Genome accession   NZ_CP085388
Coordinates   383524..383643 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain CMF18     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 378524..388643
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LIS75_RS01950 (LIS75_01960) - 380136..380819 (+) 684 WP_024084885.1 response regulator transcription factor -
  LIS75_RS01955 (LIS75_01965) - 380806..382239 (+) 1434 WP_161620115.1 HAMP domain-containing sensor histidine kinase -
  LIS75_RS01960 (LIS75_01970) rapC 382392..383540 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  LIS75_RS01965 (LIS75_01975) phrC 383524..383643 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  LIS75_RS01970 (LIS75_01980) - 383793..383888 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  LIS75_RS01975 (LIS75_01985) - 383983..385347 (-) 1365 WP_252206687.1 aspartate kinase -
  LIS75_RS01980 (LIS75_01990) ceuB 385764..386717 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  LIS75_RS01985 (LIS75_01995) - 386707..387654 (+) 948 WP_252206688.1 iron chelate uptake ABC transporter family permease subunit -
  LIS75_RS01990 (LIS75_02000) - 387648..388406 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=617251 LIS75_RS01965 WP_003156334.1 383524..383643(+) (phrC) [Bacillus velezensis strain CMF18]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=617251 LIS75_RS01965 WP_003156334.1 383524..383643(+) (phrC) [Bacillus velezensis strain CMF18]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718