Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   NPS18_RS02105 Genome accession   NZ_CP101984
Coordinates   396338..396568 (+) Length   76 a.a.
NCBI ID   WP_002275977.1    Uniprot ID   Q8DVP7
Organism   Streptococcus mutans strain UA-159     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 391338..401568
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NPS18_RS02085 (NPS18_02085) rnpM 391907..392203 (+) 297 WP_002263922.1 RNase P modulator RnpM -
  NPS18_RS02090 (NPS18_02090) - 392196..392498 (+) 303 WP_002262601.1 YlxQ-related RNA-binding protein -
  NPS18_RS10120 - 392519..392614 (+) 96 Protein_374 translation initiation factor IF-2 N-terminal domain-containing protein -
  NPS18_RS02095 (NPS18_02095) infB 393047..395269 (+) 2223 Protein_375 translation initiation factor IF-2 -
  NPS18_RS02100 (NPS18_02100) rbfA 395503..395853 (+) 351 WP_002262599.1 30S ribosome-binding factor RbfA -
  NPS18_RS02105 (NPS18_02105) cipB 396338..396568 (+) 231 WP_002275977.1 bacteriocin class II family protein Regulator
  NPS18_RS02110 (NPS18_02110) - 396959..397402 (+) 444 WP_002263708.1 CopY/TcrY family copper transport repressor -
  NPS18_RS02115 (NPS18_02115) - 397399..399627 (+) 2229 WP_002263707.1 heavy metal translocating P-type ATPase -
  NPS18_RS02120 (NPS18_02120) copZ 399640..399843 (+) 204 WP_002263706.1 copper chaperone CopZ -
  NPS18_RS02125 (NPS18_02125) - 400090..400911 (+) 822 WP_032497569.1 Cof-type HAD-IIB family hydrolase -
  NPS18_RS02130 (NPS18_02130) - 401018..401509 (-) 492 WP_011074508.1 YgjV family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 7229.19 Da        Isoelectric Point: 3.7781

>NTDB_id=613583 NPS18_RS02105 WP_002275977.1 396338..396568(+) (cipB) [Streptococcus mutans strain UA-159]
MNTQAFEQFNVMDNEALSTVEGGGMIRCALGTAGSAGLGFVGGMGAGTVTLPVVGTVSGAALGGWSGAAVGAATFC

Nucleotide


Download         Length: 231 bp        

>NTDB_id=613583 NPS18_RS02105 WP_002275977.1 396338..396568(+) (cipB) [Streptococcus mutans strain UA-159]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAACTGTTGAGGGTGGTGGTATGATTAG
ATGTGCACTTGGCACAGCTGGTTCTGCAGGTTTAGGATTTGTAGGGGGTATGGGAGCTGGTACAGTTACTCTCCCAGTCG
TTGGTACAGTATCTGGAGCGGCTTTAGGAGGCTGGTCTGGAGCAGCTGTAGGTGCTGCTACTTTTTGTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8DVP7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

71.429

55.263

0.395