Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   NP435_RS16755 Genome accession   NZ_CP101937
Coordinates   3188252..3188392 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain RUB331     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3183252..3193392
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NP435_RS16730 (NP435_16730) yuxO 3183565..3183945 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  NP435_RS16735 (NP435_16735) comA 3183964..3184608 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NP435_RS16740 (NP435_16740) comP 3184689..3186998 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  NP435_RS16745 (NP435_16745) comX 3187013..3187180 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  NP435_RS16750 (NP435_16750) comQ 3187168..3188067 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  NP435_RS16755 (NP435_16755) degQ 3188252..3188392 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NP435_RS16760 (NP435_16760) - 3188614..3188739 (+) 126 WP_003228793.1 hypothetical protein -
  NP435_RS16765 (NP435_16765) - 3188853..3189221 (+) 369 WP_003243784.1 hypothetical protein -
  NP435_RS16770 (NP435_16770) pdeH 3189197..3190426 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  NP435_RS16775 (NP435_16775) pncB 3190563..3192035 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NP435_RS16780 (NP435_16780) pncA 3192051..3192602 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  NP435_RS16785 (NP435_16785) yueI 3192699..3193097 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=613540 NP435_RS16755 WP_003220708.1 3188252..3188392(-) (degQ) [Bacillus subtilis strain RUB331]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=613540 NP435_RS16755 WP_003220708.1 3188252..3188392(-) (degQ) [Bacillus subtilis strain RUB331]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1