Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   NP434_RS12265 Genome accession   NZ_CP101936
Coordinates   2420316..2420489 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis subsp. subtilis strain BGSC 10A5     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2415316..2425489
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NP434_RS12250 (NP434_12250) gcvT 2416115..2417203 (-) 1089 WP_129092523.1 glycine cleavage system aminomethyltransferase GcvT -
  NP434_RS12255 (NP434_12255) hepAA 2417645..2419318 (+) 1674 WP_085186487.1 DEAD/DEAH box helicase -
  NP434_RS12260 (NP434_12260) yqhG 2419339..2420133 (+) 795 WP_003230200.1 YqhG family protein -
  NP434_RS12265 (NP434_12265) sinI 2420316..2420489 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NP434_RS12270 (NP434_12270) sinR 2420523..2420858 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NP434_RS12275 (NP434_12275) tasA 2420951..2421736 (-) 786 WP_212130175.1 biofilm matrix protein TasA -
  NP434_RS12280 (NP434_12280) sipW 2421800..2422372 (-) 573 WP_003246088.1 signal peptidase I SipW -
  NP434_RS12285 (NP434_12285) tapA 2422356..2423117 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  NP434_RS12290 (NP434_12290) yqzG 2423389..2423715 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NP434_RS12295 (NP434_12295) spoIITA 2423757..2423936 (-) 180 WP_029726723.1 YqzE family protein -
  NP434_RS12300 (NP434_12300) comGG 2424008..2424382 (-) 375 WP_167408283.1 ComG operon protein ComGG Machinery gene
  NP434_RS12305 (NP434_12305) comGF 2424383..2424766 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  NP434_RS12310 (NP434_12310) comGE 2424792..2425139 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=613347 NP434_RS12265 WP_003230187.1 2420316..2420489(+) (sinI) [Bacillus subtilis subsp. subtilis strain BGSC 10A5]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=613347 NP434_RS12265 WP_003230187.1 2420316..2420489(+) (sinI) [Bacillus subtilis subsp. subtilis strain BGSC 10A5]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1