Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | LG401_RS00255 | Genome accession | NZ_CP084711 |
| Coordinates | 47057..47347 (-) | Length | 96 a.a. |
| NCBI ID | WP_087975202.1 | Uniprot ID | - |
| Organism | Bacillus pumilus strain AR03 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1538..55589 | 47057..47347 | within | 0 |
Gene organization within MGE regions
Location: 1538..55589
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LG401_RS00010 (LG401_00010) | dnaN | 1538..2674 (+) | 1137 | WP_034660670.1 | DNA polymerase III subunit beta | - |
| LG401_RS00015 (LG401_00015) | yaaA | 2825..3040 (+) | 216 | WP_003215257.1 | S4 domain-containing protein YaaA | - |
| LG401_RS00020 (LG401_00020) | recF | 3057..4169 (+) | 1113 | WP_066031459.1 | DNA replication/repair protein RecF | Machinery gene |
| LG401_RS00025 (LG401_00025) | remB | 4187..4432 (+) | 246 | WP_008360920.1 | extracellular matrix regulator RemB | - |
| LG401_RS00030 (LG401_00030) | gyrB | 4490..6406 (+) | 1917 | WP_060597746.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
| LG401_RS00035 (LG401_00035) | gyrA | 6639..9143 (+) | 2505 | WP_060597709.1 | DNA gyrase subunit A | - |
| LG401_RS00065 (LG401_00065) | - | 14535..15503 (-) | 969 | WP_106037560.1 | YaaC family protein | - |
| LG401_RS00070 (LG401_00070) | guaB | 15625..17091 (+) | 1467 | WP_066031457.1 | IMP dehydrogenase | - |
| LG401_RS00075 (LG401_00075) | - | 17252..18577 (+) | 1326 | WP_034666113.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| LG401_RS00080 (LG401_00080) | - | 18619..20097 (-) | 1479 | WP_034666110.1 | PLP-dependent aminotransferase family protein | - |
| LG401_RS00085 (LG401_00085) | pdxS | 20343..21227 (+) | 885 | WP_034666107.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
| LG401_RS00090 (LG401_00090) | pdxT | 21248..21838 (+) | 591 | WP_034666104.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
| LG401_RS00095 (LG401_00095) | serS | 22158..23432 (+) | 1275 | WP_060595637.1 | serine--tRNA ligase | - |
| LG401_RS18735 | - | 24032..24364 (+) | 333 | Protein_14 | methyl-accepting chemotaxis protein | - |
| LG401_RS00110 (LG401_00110) | - | 24676..25335 (-) | 660 | WP_060595639.1 | deoxynucleoside kinase | - |
| LG401_RS00115 (LG401_00115) | - | 25332..25955 (-) | 624 | WP_034666096.1 | deoxynucleoside kinase | - |
| LG401_RS00120 (LG401_00120) | - | 26035..27282 (-) | 1248 | WP_404978212.1 | glycosyl hydrolase family 18 protein | - |
| LG401_RS00125 (LG401_00125) | - | 27382..27936 (-) | 555 | WP_060595641.1 | isochorismatase family cysteine hydrolase | - |
| LG401_RS00130 (LG401_00130) | tadA | 28016..28489 (+) | 474 | WP_106048787.1 | tRNA adenosine(34) deaminase TadA | - |
| LG401_RS00140 (LG401_00140) | dnaX | 29164..30876 (+) | 1713 | WP_060595642.1 | DNA polymerase III subunit gamma/tau | - |
| LG401_RS00145 (LG401_00145) | - | 30903..31226 (+) | 324 | WP_008342011.1 | YbaB/EbfC family nucleoid-associated protein | - |
| LG401_RS00150 (LG401_00150) | recR | 31242..31838 (+) | 597 | WP_003218094.1 | recombination protein RecR | - |
| LG401_RS00155 (LG401_00155) | - | 31857..32081 (+) | 225 | WP_003218088.1 | YaaL family protein | - |
| LG401_RS00160 (LG401_00160) | - | 32148..32411 (+) | 264 | WP_060595643.1 | pro-sigmaK processing inhibitor BofA family protein | - |
| LG401_RS00190 (LG401_00190) | - | 37876..38067 (+) | 192 | WP_003217973.1 | sigma factor G inhibitor Gin | - |
| LG401_RS00195 (LG401_00195) | - | 38197..38811 (+) | 615 | WP_106031933.1 | 5-bromo-4-chloroindolyl phosphate hydrolysis family protein | - |
| LG401_RS00200 (LG401_00200) | - | 38831..39889 (+) | 1059 | WP_106073173.1 | toxic anion resistance protein | - |
| LG401_RS00205 (LG401_00205) | - | 39967..41376 (+) | 1410 | WP_226509314.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| LG401_RS00210 (LG401_00210) | tmk | 41373..42011 (+) | 639 | WP_034665671.1 | dTMP kinase | - |
| LG401_RS00215 (LG401_00215) | - | 42091..42420 (+) | 330 | WP_024425625.1 | cyclic-di-AMP receptor | - |
| LG401_RS00220 (LG401_00220) | - | 42433..42873 (+) | 441 | WP_034665673.1 | YaaR family protein | - |
| LG401_RS00225 (LG401_00225) | holB | 42885..43874 (+) | 990 | WP_106037503.1 | DNA polymerase III subunit delta' | - |
| LG401_RS00230 (LG401_00230) | - | 43877..44705 (+) | 829 | Protein_33 | stage 0 sporulation family protein | - |
| LG401_RS00235 (LG401_00235) | yabA | 44720..45073 (+) | 354 | WP_003217957.1 | DNA replication initiation control protein YabA | - |
| LG401_RS00240 (LG401_00240) | - | 45129..45872 (+) | 744 | WP_106037504.1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | - |
| LG401_RS00245 (LG401_00245) | - | 45859..46155 (+) | 297 | WP_003217970.1 | GIY-YIG nuclease family protein | - |
| LG401_RS00250 (LG401_00250) | rsmI | 46133..47011 (+) | 879 | WP_106039736.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| LG401_RS00255 (LG401_00255) | abrB | 47057..47347 (-) | 291 | WP_087975202.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| LG401_RS00260 (LG401_00260) | metG | 47868..49865 (+) | 1998 | WP_106071956.1 | methionine--tRNA ligase | - |
| LG401_RS00265 (LG401_00265) | - | 49948..50715 (+) | 768 | WP_034665688.1 | TatD family hydrolase | - |
| LG401_RS00270 (LG401_00270) | - | 50960..52162 (+) | 1203 | WP_034665691.1 | G5 and 3D domain-containing protein | - |
| LG401_RS00275 (LG401_00275) | rnmV | 52323..52883 (+) | 561 | WP_012008650.1 | ribonuclease M5 | - |
| LG401_RS00280 (LG401_00280) | rsmA | 52876..53754 (+) | 879 | WP_034665697.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| LG401_RS00285 (LG401_00285) | yabG | 53885..54769 (+) | 885 | WP_012008652.1 | sporulation peptidase YabG | - |
| LG401_RS00290 (LG401_00290) | veg | 54983..55240 (+) | 258 | WP_003217979.1 | biofilm formation stimulator Veg | - |
| LG401_RS00295 (LG401_00295) | - | 55404..55589 (+) | 186 | WP_012008653.1 | small, acid-soluble spore protein, alpha/beta type | - |
Sequence
Protein
Download Length: 96 a.a. Molecular weight: 10853.65 Da Isoelectric Point: 7.9655
>NTDB_id=612596 LG401_RS00255 WP_087975202.1 47057..47347(-) (abrB) [Bacillus pumilus strain AR03]
MKMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLANGKLVLSREG
AEQIINEIQNQLQSQK
MKMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLANGKLVLSREG
AEQIINEIQNQLQSQK
Nucleotide
Download Length: 291 bp
>NTDB_id=612596 LG401_RS00255 WP_087975202.1 47057..47347(-) (abrB) [Bacillus pumilus strain AR03]
ATGAAGATGAAATCTACAGGTATTGTACGTAAAGTTGACGAATTAGGACGCGTGGTGATTCCAATCGAACTTCGCCGTAC
TCTAGGAATCGCTGAAAAAGACGCTTTGGAAATTTATGTTGATGATGAAAAAATTATCCTAAAAAAATATAAACCAAACA
TGACTTGCCAAGTTACAGGTGAAGTATCAGACGATAACCTTAAACTTGCTAATGGTAAATTAGTTCTTAGCCGTGAAGGT
GCAGAGCAAATCATTAACGAAATCCAAAACCAACTTCAATCACAAAAATAA
ATGAAGATGAAATCTACAGGTATTGTACGTAAAGTTGACGAATTAGGACGCGTGGTGATTCCAATCGAACTTCGCCGTAC
TCTAGGAATCGCTGAAAAAGACGCTTTGGAAATTTATGTTGATGATGAAAAAATTATCCTAAAAAAATATAAACCAAACA
TGACTTGCCAAGTTACAGGTGAAGTATCAGACGATAACCTTAAACTTGCTAATGGTAAATTAGTTCTTAGCCGTGAAGGT
GCAGAGCAAATCATTAACGAAATCCAAAACCAACTTCAATCACAAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
93.75 |
100 |
0.938 |