Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   NMT99_RS16315 Genome accession   NZ_CP101290
Coordinates   3129651..3129791 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain LjM2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3124651..3134791
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NMT99_RS16290 yuxO 3124927..3125307 (-) 381 WP_015714624.1 hotdog fold thioesterase -
  NMT99_RS16295 comA 3125326..3125970 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NMT99_RS16300 comP 3126051..3128363 (-) 2313 WP_069703660.1 histidine kinase Regulator
  NMT99_RS16305 comX 3128379..3128600 (-) 222 WP_014480704.1 competence pheromone ComX -
  NMT99_RS16310 comQ 3128602..3129465 (-) 864 WP_043858576.1 polyprenyl synthetase family protein Regulator
  NMT99_RS16315 degQ 3129651..3129791 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NMT99_RS16320 - 3130013..3130075 (+) 63 Protein_3156 hypothetical protein -
  NMT99_RS16325 - 3130253..3130621 (+) 369 WP_017695529.1 hypothetical protein -
  NMT99_RS16330 pdeH 3130597..3131826 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  NMT99_RS16335 pncB 3131963..3133435 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NMT99_RS16340 pncA 3133451..3134002 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  NMT99_RS16345 yueI 3134099..3134497 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=610052 NMT99_RS16315 WP_003220708.1 3129651..3129791(-) (degQ) [Bacillus subtilis strain LjM2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=610052 NMT99_RS16315 WP_003220708.1 3129651..3129791(-) (degQ) [Bacillus subtilis strain LjM2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1