Detailed information    

experimental Experimentally validated

Overview


Name   epdE   Type   Machinery gene
Locus tag   MMJJ_RS05695 Genome accession   NZ_CP026606
Coordinates   1061520..1061741 (+) Length   73 a.a.
NCBI ID   WP_104838033.1    Uniprot ID   A0A2L1CB12
Organism   Methanococcus maripaludis strain DSM 2067     
Function   DNA uptake   
DNA binding and uptake

Function


Both the MMJJ_RS05685 and ΔepdE mutants were defective in transformation, but complementation of these deletions rescued the mutants.


Genomic Context


Location: 1056520..1066741
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MMJJ_RS05665 (MMJJ_11410) - 1056898..1057581 (-) 684 WP_104838027.1 DUF7388 family protein -
  MMJJ_RS05670 (MMJJ_11420) - 1057593..1057799 (-) 207 WP_104838028.1 4Fe-4S dicluster domain-containing protein -
  MMJJ_RS05675 (MMJJ_11430) - 1057815..1058816 (-) 1002 WP_104838029.1 RNA-guided pseudouridylation complex pseudouridine synthase subunit Cbf5 -
  MMJJ_RS05680 (MMJJ_11440) - 1058834..1059031 (-) 198 WP_104838030.1 AtpZ/AtpI family protein -
  MMJJ_RS05685 (MMJJ_11450) MMJJ_RS05685 1059447..1059677 (+) 231 WP_104838031.1 class III signal peptide-containing protein Machinery gene
  MMJJ_RS05690 (MMJJ_11460) - 1059952..1061487 (+) 1536 WP_211286607.1 DUF6541 family protein -
  MMJJ_RS05695 (MMJJ_11470) epdE 1061520..1061741 (+) 222 WP_104838033.1 class III signal peptide-containing protein Machinery gene
  MMJJ_RS05700 (MMJJ_11480) - 1061753..1062436 (+) 684 WP_104838034.1 metallophosphoesterase family protein -
  MMJJ_RS05705 (MMJJ_11490) - 1062437..1063003 (-) 567 WP_244901525.1 hypothetical protein -
  MMJJ_RS05710 (MMJJ_11500) recJ 1063211..1064614 (+) 1404 WP_104838036.1 single-stranded-DNA-specific exonuclease RecJ -
  MMJJ_RS05715 (MMJJ_11510) - 1064663..1065949 (+) 1287 WP_104838037.1 phosphoadenosine phosphosulfate reductase family protein -

Sequence


Protein


Download         Length: 73 a.a.        Molecular weight: 7648.74 Da        Isoelectric Point: 6.1356

>NTDB_id=61 MMJJ_RS05695 WP_104838033.1 1061520..1061741(+) (epdE) [Methanococcus maripaludis strain DSM 2067]
MKFLEKITSKKGQIAMELGILVMAAVAVAAIAAYFYATNVSNTGKQITNSTNQTTQALADAISDATSELSSYA

Nucleotide


Download         Length: 222 bp        

>NTDB_id=61 MMJJ_RS05695 WP_104838033.1 1061520..1061741(+) (epdE) [Methanococcus maripaludis strain DSM 2067]
ATGAAATTTTTAGAAAAAATAACATCAAAAAAAGGTCAAATAGCAATGGAACTCGGAATACTGGTTATGGCGGCAGTTGC
AGTTGCAGCAATCGCAGCATACTTTTATGCAACGAATGTTAGCAATACTGGAAAACAGATTACAAATTCGACAAACCAGA
CAACTCAGGCACTCGCTGATGCAATATCTGATGCTACATCAGAACTGTCTAGCTACGCATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2L1CB12

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  MMJJ_RS05685 Methanococcus maripaludis strain DSM 2067

63.38

97.26

0.616


Multiple sequence alignment    



References


[1] Dallas R Fonseca et al. (2020) Type IV-Like Pili Facilitate Transformation in Naturally Competent Archaea. Journal of Bacteriology 202(21):e00355-20. [PMID: 32817089]