Detailed information    

experimental Experimentally validated

Overview


Name   MMJJ_RS05685   Type   Machinery gene
Locus tag   MMJJ_RS05685 Genome accession   NZ_CP026606
Coordinates   1059447..1059677 (+) Length   76 a.a.
NCBI ID   WP_104838031.1    Uniprot ID   -
Organism   Methanococcus maripaludis strain DSM 2067     
Function   DNA uptake   
DNA binding and uptake

Function


Both the MMJJ_RS05685 and ΔepdE mutants were defective in transformation, but complementation of these deletions rescued the mutants.


Genomic Context


Location: 1054447..1064677
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MMJJ_RS05655 (MMJJ_11390) - 1055658..1056326 (+) 669 WP_104838025.1 HisA/HisF family protein -
  MMJJ_RS05660 (MMJJ_11400) comE 1056328..1056885 (+) 558 WP_104838026.1 sulfopyruvate decarboxylase subunit beta -
  MMJJ_RS05665 (MMJJ_11410) - 1056898..1057581 (-) 684 WP_104838027.1 DUF7388 family protein -
  MMJJ_RS05670 (MMJJ_11420) - 1057593..1057799 (-) 207 WP_104838028.1 4Fe-4S dicluster domain-containing protein -
  MMJJ_RS05675 (MMJJ_11430) - 1057815..1058816 (-) 1002 WP_104838029.1 RNA-guided pseudouridylation complex pseudouridine synthase subunit Cbf5 -
  MMJJ_RS05680 (MMJJ_11440) - 1058834..1059031 (-) 198 WP_104838030.1 AtpZ/AtpI family protein -
  MMJJ_RS05685 (MMJJ_11450) MMJJ_RS05685 1059447..1059677 (+) 231 WP_104838031.1 class III signal peptide-containing protein Machinery gene
  MMJJ_RS05690 (MMJJ_11460) - 1059952..1061487 (+) 1536 WP_211286607.1 DUF6541 family protein -
  MMJJ_RS05695 (MMJJ_11470) epdE 1061520..1061741 (+) 222 WP_104838033.1 class III signal peptide-containing protein Machinery gene
  MMJJ_RS05700 (MMJJ_11480) - 1061753..1062436 (+) 684 WP_104838034.1 metallophosphoesterase family protein -
  MMJJ_RS05705 (MMJJ_11490) - 1062437..1063003 (-) 567 WP_244901525.1 hypothetical protein -
  MMJJ_RS05710 (MMJJ_11500) recJ 1063211..1064614 (+) 1404 WP_104838036.1 single-stranded-DNA-specific exonuclease RecJ -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 7583.65 Da        Isoelectric Point: 8.5477

>NTDB_id=60 MMJJ_RS05685 WP_104838031.1 1059447..1059677(+) (MMJJ_RS05685) [Methanococcus maripaludis strain DSM 2067]
MKFLEKLTSKKGQVSMEIGILVAAAVAVAAIAAYFYATNVKNAQADTGASAASTTGNLTNIADSATSGISSITLTA

Nucleotide


Download         Length: 231 bp        

>NTDB_id=60 MMJJ_RS05685 WP_104838031.1 1059447..1059677(+) (MMJJ_RS05685) [Methanococcus maripaludis strain DSM 2067]
ATGAAATTTTTAGAAAAACTAACATCAAAAAAAGGTCAGGTATCAATGGAAATTGGTATCCTCGTTGCAGCAGCAGTTGC
AGTTGCAGCAATCGCAGCATACTTCTACGCAACAAACGTTAAAAATGCGCAAGCAGATACTGGAGCATCAGCTGCATCAA
CAACAGGTAATTTAACAAATATTGCAGATAGTGCAACATCGGGAATTTCATCTATTACGCTGACTGCGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  epdE Methanococcus maripaludis strain DSM 2067

63.38

97.26

0.616


Multiple sequence alignment    



References


[1] Dallas R Fonseca et al. (2020) Type IV-Like Pili Facilitate Transformation in Naturally Competent Archaea. Journal of Bacteriology 202(21):e00355-20. [PMID: 32817089]