Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   K9N56_RS14955 Genome accession   NZ_CP083580
Coordinates   2946666..2946839 (+) Length   57 a.a.
NCBI ID   WP_006637527.1    Uniprot ID   -
Organism   Bacillus sp. PM8313     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2941666..2951839
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K9N56_RS14940 (K9N56_14940) gcvT 2942318..2943412 (-) 1095 WP_006637524.1 glycine cleavage system aminomethyltransferase GcvT -
  K9N56_RS14945 (K9N56_14945) - 2943999..2945678 (+) 1680 WP_006637525.1 DEAD/DEAH box helicase -
  K9N56_RS14950 (K9N56_14950) - 2945682..2946476 (+) 795 WP_006637526.1 YqhG family protein -
  K9N56_RS14955 (K9N56_14955) sinI 2946666..2946839 (+) 174 WP_006637527.1 anti-repressor SinI Regulator
  K9N56_RS14960 (K9N56_14960) sinR 2946873..2947208 (+) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  K9N56_RS14965 (K9N56_14965) tasA 2947316..2948110 (-) 795 WP_006637529.1 biofilm matrix protein TasA -
  K9N56_RS14970 (K9N56_14970) sipW 2948180..2948761 (-) 582 WP_006637530.1 signal peptidase I SipW -
  K9N56_RS14975 (K9N56_14975) tapA 2948758..2949504 (-) 747 WP_006637531.1 amyloid fiber anchoring/assembly protein TapA -
  K9N56_RS14980 (K9N56_14980) - 2949767..2950087 (+) 321 WP_006637532.1 DUF3889 domain-containing protein -
  K9N56_RS14985 (K9N56_14985) - 2950181..2950366 (-) 186 WP_006637533.1 YqzE family protein -
  K9N56_RS14990 (K9N56_14990) comGG 2950446..2950769 (-) 324 WP_224254418.1 competence type IV pilus minor pilin ComGG -
  K9N56_RS14995 (K9N56_14995) comGF 2950824..2951315 (-) 492 WP_224254419.1 competence type IV pilus minor pilin ComGF -
  K9N56_RS15000 (K9N56_15000) comGE 2951224..2951571 (-) 348 WP_006637536.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6504.38 Da        Isoelectric Point: 5.6746

>NTDB_id=606299 K9N56_RS14955 WP_006637527.1 2946666..2946839(+) (sinI) [Bacillus sp. PM8313]
MKAKSEKEELDKEWEDLIKSALRAGISPEEIRIFLNLGHKPSEASTPIERSHSINPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=606299 K9N56_RS14955 WP_006637527.1 2946666..2946839(+) (sinI) [Bacillus sp. PM8313]
ATGAAAGCGAAAAGTGAGAAGGAAGAATTGGACAAGGAGTGGGAAGATCTCATCAAAAGCGCTCTCAGAGCAGGTATTAG
TCCAGAGGAAATAAGAATTTTTCTCAATTTGGGTCATAAGCCTTCGGAAGCTTCCACACCAATTGAAAGAAGTCATTCAA
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(10-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

52.727

96.491

0.509