Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   K9864_RS16545 Genome accession   NZ_CP083436
Coordinates   3274279..3274419 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain HC-8     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3269279..3279419
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K9864_RS16520 (K9864_16410) - 3269593..3269976 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  K9864_RS16525 (K9864_16415) comA 3269998..3270642 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  K9864_RS16530 (K9864_16420) comP 3270723..3273074 (-) 2352 WP_269800792.1 sensor histidine kinase Regulator
  K9864_RS16535 (K9864_16425) comX 3273052..3273222 (-) 171 WP_032863917.1 competence pheromone ComX -
  K9864_RS16540 (K9864_16430) - 3273222..3274127 (-) 906 WP_014418764.1 polyprenyl synthetase family protein -
  K9864_RS16545 (K9864_16435) degQ 3274279..3274419 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  K9864_RS16550 (K9864_16440) - 3274885..3275226 (+) 342 WP_014418765.1 hypothetical protein -
  K9864_RS16555 (K9864_16445) - 3275233..3276456 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  K9864_RS16560 (K9864_16450) - 3276586..3278052 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  K9864_RS16565 (K9864_16455) - 3278070..3278621 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  K9864_RS16570 (K9864_16460) - 3278718..3279116 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=605812 K9864_RS16545 WP_003152043.1 3274279..3274419(-) (degQ) [Bacillus velezensis strain HC-8]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=605812 K9864_RS16545 WP_003152043.1 3274279..3274419(-) (degQ) [Bacillus velezensis strain HC-8]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891