Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   K8Z53_RS05970 Genome accession   NZ_CP083238
Coordinates   1080336..1080476 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain 2709     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1075336..1085476
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K8Z53_RS05945 (K8Z53_05870) - 1075656..1076045 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  K8Z53_RS05950 (K8Z53_05875) comA 1076062..1076700 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  K8Z53_RS05955 (K8Z53_05880) comP 1076787..1079087 (-) 2301 WP_009329509.1 ATP-binding protein Regulator
  K8Z53_RS05960 (K8Z53_05885) comX 1079089..1079262 (-) 174 WP_142782424.1 competence pheromone ComX -
  K8Z53_RS05965 (K8Z53_05890) - 1079266..1080147 (-) 882 WP_009329511.1 polyprenyl synthetase family protein -
  K8Z53_RS05970 (K8Z53_05895) degQ 1080336..1080476 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  K8Z53_RS05975 (K8Z53_05900) - 1080962..1081309 (+) 348 WP_009329512.1 hypothetical protein -
  K8Z53_RS05980 (K8Z53_05905) - 1081352..1082571 (-) 1220 Protein_1167 EAL and HDOD domain-containing protein -
  K8Z53_RS05985 (K8Z53_05910) - 1082750..1084159 (-) 1410 WP_228767691.1 nicotinate phosphoribosyltransferase -
  K8Z53_RS05990 (K8Z53_05915) - 1084237..1084788 (-) 552 WP_003184868.1 cysteine hydrolase family protein -
  K8Z53_RS05995 (K8Z53_05920) - 1084973..1085374 (-) 402 WP_003184870.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=605074 K8Z53_RS05970 WP_003184860.1 1080336..1080476(-) (degQ) [Bacillus licheniformis strain 2709]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=605074 K8Z53_RS05970 WP_003184860.1 1080336..1080476(-) (degQ) [Bacillus licheniformis strain 2709]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652