Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | K8Z20_RS20575 | Genome accession | NZ_CP083156 |
| Coordinates | 3999781..4000059 (-) | Length | 92 a.a. |
| NCBI ID | WP_021728995.1 | Uniprot ID | A0A9X6Q7R2 |
| Organism | Bacillus thuringiensis strain ABTS-1857 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3967252..4008026 | 3999781..4000059 | within | 0 |
Gene organization within MGE regions
Location: 3967252..4008026
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K8Z20_RS20340 (K8Z20_20105) | - | 3967252..3967902 (-) | 651 | WP_000183862.1 | 2OG-Fe(II) oxygenase | - |
| K8Z20_RS20345 (K8Z20_20110) | comGG | 3968079..3968450 (-) | 372 | WP_001231273.1 | competence type IV pilus minor pilin ComGG | - |
| K8Z20_RS20350 (K8Z20_20115) | - | 3968447..3968752 (-) | 306 | Protein_4020 | ComGF family competence protein | - |
| K8Z20_RS20355 (K8Z20_20120) | - | 3968922..3969545 (-) | 624 | WP_023901143.1 | replication-relaxation family protein | - |
| K8Z20_RS20360 (K8Z20_20125) | - | 3969487..3970668 (-) | 1182 | WP_021727693.1 | FtsK/SpoIIIE domain-containing protein | - |
| K8Z20_RS20365 (K8Z20_20130) | - | 3970784..3970966 (-) | 183 | WP_021727692.1 | hypothetical protein | - |
| K8Z20_RS20370 (K8Z20_20135) | - | 3970969..3971271 (-) | 303 | WP_023901502.1 | hypothetical protein | - |
| K8Z20_RS20375 (K8Z20_20140) | - | 3971435..3971632 (+) | 198 | WP_021727690.1 | helix-turn-helix domain-containing protein | - |
| K8Z20_RS20380 (K8Z20_20145) | - | 3971654..3971920 (+) | 267 | WP_021727689.1 | hypothetical protein | - |
| K8Z20_RS20385 (K8Z20_20150) | - | 3972120..3972938 (-) | 819 | WP_021728191.1 | GH25 family lysozyme | - |
| K8Z20_RS20390 (K8Z20_20155) | - | 3972938..3973363 (-) | 426 | WP_000373895.1 | phage holin family protein | - |
| K8Z20_RS20395 (K8Z20_20160) | - | 3973379..3974338 (-) | 960 | WP_021728192.1 | site-specific integrase | - |
| K8Z20_RS20400 (K8Z20_20165) | - | 3974461..3975741 (-) | 1281 | WP_021728193.1 | BppU family phage baseplate upper protein | - |
| K8Z20_RS20405 (K8Z20_20170) | - | 3975756..3978161 (-) | 2406 | WP_021728194.1 | phage tail spike protein | - |
| K8Z20_RS20410 (K8Z20_20175) | - | 3978161..3978844 (-) | 684 | WP_023901438.1 | phage tail domain-containing protein | - |
| K8Z20_RS20415 (K8Z20_20180) | - | 3978846..3981686 (-) | 2841 | WP_228220127.1 | hypothetical protein | - |
| K8Z20_RS20420 (K8Z20_20185) | - | 3982194..3983774 (-) | 1581 | WP_021727576.1 | hypothetical protein | - |
| K8Z20_RS20425 (K8Z20_20190) | - | 3983953..3984414 (-) | 462 | WP_021727577.1 | hypothetical protein | - |
| K8Z20_RS20430 (K8Z20_20195) | - | 3984486..3985070 (-) | 585 | WP_021727578.1 | major tail protein B | - |
| K8Z20_RS20435 (K8Z20_20200) | - | 3985071..3985499 (-) | 429 | WP_021727579.1 | hypothetical protein | - |
| K8Z20_RS20440 (K8Z20_20205) | - | 3985486..3985887 (-) | 402 | WP_021727580.1 | hypothetical protein | - |
| K8Z20_RS20445 (K8Z20_20210) | - | 3985880..3986236 (-) | 357 | WP_021727581.1 | phage head closure protein | - |
| K8Z20_RS20450 (K8Z20_20215) | - | 3986217..3986513 (-) | 297 | WP_021727582.1 | hypothetical protein | - |
| K8Z20_RS20460 (K8Z20_20225) | - | 3986654..3987817 (-) | 1164 | WP_021727584.1 | phage major capsid protein | - |
| K8Z20_RS20465 (K8Z20_20230) | - | 3987860..3988576 (-) | 717 | WP_021727585.1 | head maturation protease, ClpP-related | - |
| K8Z20_RS20470 (K8Z20_20235) | - | 3988563..3989729 (-) | 1167 | WP_021727586.1 | phage portal protein | - |
| K8Z20_RS20475 (K8Z20_20240) | - | 3989743..3991395 (-) | 1653 | WP_021727587.1 | terminase TerL endonuclease subunit | - |
| K8Z20_RS20480 (K8Z20_20245) | - | 3991382..3991693 (-) | 312 | WP_021727588.1 | hypothetical protein | - |
| K8Z20_RS20485 (K8Z20_20250) | - | 3991799..3992107 (-) | 309 | WP_021727589.1 | hypothetical protein | - |
| K8Z20_RS20490 (K8Z20_20255) | - | 3992110..3992379 (-) | 270 | WP_228220125.1 | HNH endonuclease signature motif containing protein | - |
| K8Z20_RS20495 (K8Z20_20260) | - | 3992418..3992663 (-) | 246 | WP_021727591.1 | hypothetical protein | - |
| K8Z20_RS20500 (K8Z20_20265) | - | 3992855..3993151 (-) | 297 | WP_021727593.1 | hypothetical protein | - |
| K8Z20_RS20505 (K8Z20_20270) | - | 3993158..3993388 (-) | 231 | WP_021727594.1 | hypothetical protein | - |
| K8Z20_RS20510 (K8Z20_20275) | - | 3993372..3993866 (-) | 495 | WP_021727595.1 | hypothetical protein | - |
| K8Z20_RS20515 (K8Z20_20280) | - | 3993866..3994057 (-) | 192 | WP_021727596.1 | hypothetical protein | - |
| K8Z20_RS20520 (K8Z20_20285) | - | 3994661..3995203 (-) | 543 | WP_021727597.1 | tyrosine-type recombinase/integrase | - |
| K8Z20_RS20525 (K8Z20_20290) | - | 3995200..3995670 (-) | 471 | WP_021727598.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| K8Z20_RS20530 (K8Z20_20295) | - | 3995691..3995861 (-) | 171 | WP_021727599.1 | hypothetical protein | - |
| K8Z20_RS20535 (K8Z20_20300) | - | 3996121..3996363 (-) | 243 | WP_021727600.1 | hypothetical protein | - |
| K8Z20_RS20540 (K8Z20_20305) | - | 3996902..3997084 (-) | 183 | WP_021727601.1 | hypothetical protein | - |
| K8Z20_RS20545 (K8Z20_20310) | - | 3997123..3997320 (-) | 198 | WP_021727602.1 | hypothetical protein | - |
| K8Z20_RS20550 (K8Z20_20315) | - | 3997912..3998319 (-) | 408 | WP_016090376.1 | hypothetical protein | - |
| K8Z20_RS20555 (K8Z20_20320) | - | 3998490..3998945 (-) | 456 | WP_021728086.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| K8Z20_RS20560 (K8Z20_20325) | - | 3998965..3999216 (-) | 252 | WP_000109496.1 | hypothetical protein | - |
| K8Z20_RS20565 (K8Z20_20330) | - | 3999242..3999409 (-) | 168 | WP_000717826.1 | DUF3954 domain-containing protein | - |
| K8Z20_RS20570 (K8Z20_20335) | - | 3999429..3999788 (-) | 360 | WP_021728087.1 | hypothetical protein | - |
| K8Z20_RS20575 (K8Z20_20340) | abrB | 3999781..4000059 (-) | 279 | WP_021728995.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| K8Z20_RS20580 (K8Z20_20345) | - | 4000076..4000270 (-) | 195 | WP_021727623.1 | hypothetical protein | - |
| K8Z20_RS20585 (K8Z20_20350) | - | 4000286..4001089 (-) | 804 | WP_021727624.1 | ATP-binding protein | - |
| K8Z20_RS20590 (K8Z20_20355) | - | 4001058..4001870 (-) | 813 | WP_021727625.1 | phage replisome organizer N-terminal domain-containing protein | - |
| K8Z20_RS20595 (K8Z20_20360) | - | 4001876..4002052 (-) | 177 | WP_021727626.1 | hypothetical protein | - |
| K8Z20_RS20600 (K8Z20_20365) | - | 4002082..4002246 (-) | 165 | WP_021727627.1 | hypothetical protein | - |
| K8Z20_RS20605 (K8Z20_20370) | - | 4002259..4002519 (-) | 261 | WP_021727628.1 | hypothetical protein | - |
| K8Z20_RS20610 (K8Z20_20375) | - | 4002558..4003280 (-) | 723 | WP_021727629.1 | ORF6C domain-containing protein | - |
| K8Z20_RS20615 (K8Z20_20380) | - | 4003367..4003561 (-) | 195 | WP_021727630.1 | helix-turn-helix transcriptional regulator | - |
| K8Z20_RS20620 (K8Z20_20385) | - | 4003757..4004116 (+) | 360 | WP_021727631.1 | helix-turn-helix transcriptional regulator | - |
| K8Z20_RS34760 | - | 4004152..4004274 (-) | 123 | WP_021727632.1 | hypothetical protein | - |
| K8Z20_RS20625 (K8Z20_20390) | - | 4004441..4004587 (-) | 147 | WP_021727633.1 | hypothetical protein | - |
| K8Z20_RS20630 (K8Z20_20395) | - | 4004628..4005779 (-) | 1152 | WP_021727634.1 | AimR family lysis-lysogeny pheromone receptor | - |
| K8Z20_RS20635 (K8Z20_20400) | - | 4006310..4006654 (+) | 345 | WP_021727635.1 | helix-turn-helix transcriptional regulator | - |
| K8Z20_RS20640 (K8Z20_20405) | - | 4006857..4008026 (+) | 1170 | WP_021727636.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10030.64 Da Isoelectric Point: 8.0497
>NTDB_id=604899 K8Z20_RS20575 WP_021728995.1 3999781..4000059(-) (abrB) [Bacillus thuringiensis strain ABTS-1857]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENIVLRKQDKSCFVTGKVPDSNIELLGGRMFLSKEGALEL
LNSLEKSVKEHG
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENIVLRKQDKSCFVTGKVPDSNIELLGGRMFLSKEGALEL
LNSLEKSVKEHG
Nucleotide
Download Length: 279 bp
>NTDB_id=604899 K8Z20_RS20575 WP_021728995.1 3999781..4000059(-) (abrB) [Bacillus thuringiensis strain ABTS-1857]
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACAGGATAAGTCATGCTTTG
TTACGGGTAAAGTACCTGATTCCAACATCGAATTGTTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGGGCACTTGAGTTA
CTCAACTCTCTTGAAAAGAGTGTGAAGGAACATGGCTAA
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACAGGATAAGTCATGCTTTG
TTACGGGTAAAGTACCTGATTCCAACATCGAATTGTTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGGGCACTTGAGTTA
CTCAACTCTCTTGAAAAGAGTGTGAAGGAACATGGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
53.846 |
98.913 |
0.533 |