Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | K8Z38_RS20770 | Genome accession | NZ_CP083144 |
| Coordinates | 4050863..4051141 (-) | Length | 92 a.a. |
| NCBI ID | WP_021728995.1 | Uniprot ID | A0A9X6Q7R2 |
| Organism | Bacillus thuringiensis strain GC-91 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 4018334..4059108 | 4050863..4051141 | within | 0 |
Gene organization within MGE regions
Location: 4018334..4059108
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K8Z38_RS20535 (K8Z38_20485) | - | 4018334..4018984 (-) | 651 | WP_000183862.1 | 2OG-Fe(II) oxygenase | - |
| K8Z38_RS20540 (K8Z38_20490) | comGG | 4019161..4019532 (-) | 372 | WP_001231273.1 | competence type IV pilus minor pilin ComGG | - |
| K8Z38_RS20545 (K8Z38_20495) | - | 4019529..4019834 (-) | 306 | Protein_4059 | competence type IV pilus minor pilin ComGF | - |
| K8Z38_RS20550 (K8Z38_20500) | - | 4020004..4020627 (-) | 624 | WP_023901143.1 | replication-relaxation family protein | - |
| K8Z38_RS20555 (K8Z38_20505) | - | 4020569..4021750 (-) | 1182 | WP_021727693.1 | FtsK/SpoIIIE domain-containing protein | - |
| K8Z38_RS20560 (K8Z38_20510) | - | 4021866..4022048 (-) | 183 | WP_021727692.1 | hypothetical protein | - |
| K8Z38_RS20565 (K8Z38_20515) | - | 4022051..4022353 (-) | 303 | WP_023901502.1 | hypothetical protein | - |
| K8Z38_RS20570 (K8Z38_20520) | - | 4022517..4022714 (+) | 198 | WP_021727690.1 | helix-turn-helix transcriptional regulator | - |
| K8Z38_RS20575 (K8Z38_20525) | - | 4022736..4023002 (+) | 267 | WP_021727689.1 | hypothetical protein | - |
| K8Z38_RS20580 (K8Z38_20530) | - | 4023202..4024020 (-) | 819 | WP_021728191.1 | GH25 family lysozyme | - |
| K8Z38_RS20585 (K8Z38_20535) | - | 4024020..4024445 (-) | 426 | WP_000373895.1 | holin family protein | - |
| K8Z38_RS20590 (K8Z38_20540) | - | 4024461..4025420 (-) | 960 | WP_021728192.1 | site-specific integrase | - |
| K8Z38_RS20595 (K8Z38_20545) | - | 4025543..4026823 (-) | 1281 | WP_021728193.1 | BppU family phage baseplate upper protein | - |
| K8Z38_RS20600 (K8Z38_20550) | - | 4026838..4029243 (-) | 2406 | WP_021728194.1 | phage tail spike protein | - |
| K8Z38_RS20605 (K8Z38_20555) | - | 4029243..4029926 (-) | 684 | WP_023901438.1 | phage tail domain-containing protein | - |
| K8Z38_RS20610 (K8Z38_20560) | - | 4029928..4032768 (-) | 2841 | WP_228220127.1 | hypothetical protein | - |
| K8Z38_RS20615 (K8Z38_20565) | - | 4033276..4034856 (-) | 1581 | WP_021727576.1 | hypothetical protein | - |
| K8Z38_RS20620 (K8Z38_20570) | - | 4035035..4035496 (-) | 462 | WP_021727577.1 | hypothetical protein | - |
| K8Z38_RS20625 (K8Z38_20575) | - | 4035568..4036152 (-) | 585 | WP_021727578.1 | major tail protein B | - |
| K8Z38_RS20630 (K8Z38_20580) | - | 4036153..4036581 (-) | 429 | WP_021727579.1 | hypothetical protein | - |
| K8Z38_RS20635 (K8Z38_20585) | - | 4036568..4036969 (-) | 402 | WP_021727580.1 | hypothetical protein | - |
| K8Z38_RS20640 (K8Z38_20590) | - | 4036962..4037318 (-) | 357 | WP_021727581.1 | phage head closure protein | - |
| K8Z38_RS20645 (K8Z38_20595) | - | 4037299..4037595 (-) | 297 | WP_021727582.1 | hypothetical protein | - |
| K8Z38_RS35250 | - | 4037588..4037674 (-) | 87 | WP_021727583.1 | hypothetical protein | - |
| K8Z38_RS20655 (K8Z38_20605) | - | 4037736..4038899 (-) | 1164 | WP_021727584.1 | phage major capsid protein | - |
| K8Z38_RS20660 (K8Z38_20610) | - | 4038942..4039658 (-) | 717 | WP_021727585.1 | head maturation protease, ClpP-related | - |
| K8Z38_RS20665 (K8Z38_20615) | - | 4039645..4040811 (-) | 1167 | WP_021727586.1 | phage portal protein | - |
| K8Z38_RS20670 (K8Z38_20620) | - | 4040825..4042477 (-) | 1653 | WP_021727587.1 | terminase TerL endonuclease subunit | - |
| K8Z38_RS20675 (K8Z38_20625) | - | 4042464..4042775 (-) | 312 | WP_021727588.1 | hypothetical protein | - |
| K8Z38_RS20680 (K8Z38_20630) | - | 4042881..4043189 (-) | 309 | WP_021727589.1 | hypothetical protein | - |
| K8Z38_RS20685 (K8Z38_20635) | - | 4043192..4043461 (-) | 270 | WP_228220125.1 | HNH endonuclease signature motif containing protein | - |
| K8Z38_RS20690 (K8Z38_20640) | - | 4043500..4043745 (-) | 246 | WP_021727591.1 | hypothetical protein | - |
| K8Z38_RS20695 (K8Z38_20645) | - | 4043937..4044233 (-) | 297 | WP_021727593.1 | hypothetical protein | - |
| K8Z38_RS20700 (K8Z38_20650) | - | 4044240..4044470 (-) | 231 | WP_021727594.1 | hypothetical protein | - |
| K8Z38_RS20705 (K8Z38_20655) | - | 4044454..4044948 (-) | 495 | WP_021727595.1 | hypothetical protein | - |
| K8Z38_RS20710 (K8Z38_20660) | - | 4044948..4045139 (-) | 192 | WP_021727596.1 | hypothetical protein | - |
| K8Z38_RS20715 (K8Z38_20665) | - | 4045743..4046285 (-) | 543 | WP_021727597.1 | tyrosine-type recombinase/integrase | - |
| K8Z38_RS20720 (K8Z38_20670) | - | 4046282..4046752 (-) | 471 | WP_021727598.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| K8Z38_RS20725 (K8Z38_20675) | - | 4046773..4046943 (-) | 171 | WP_021727599.1 | hypothetical protein | - |
| K8Z38_RS20730 (K8Z38_20680) | - | 4047203..4047445 (-) | 243 | WP_021727600.1 | hypothetical protein | - |
| K8Z38_RS20735 (K8Z38_20685) | - | 4047984..4048166 (-) | 183 | WP_021727601.1 | hypothetical protein | - |
| K8Z38_RS20740 (K8Z38_20690) | - | 4048205..4048402 (-) | 198 | WP_021727602.1 | hypothetical protein | - |
| K8Z38_RS20745 (K8Z38_20695) | - | 4048994..4049401 (-) | 408 | WP_016090376.1 | hypothetical protein | - |
| K8Z38_RS20750 (K8Z38_20700) | - | 4049572..4050027 (-) | 456 | WP_021728086.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| K8Z38_RS20755 (K8Z38_20705) | - | 4050047..4050298 (-) | 252 | WP_000109496.1 | hypothetical protein | - |
| K8Z38_RS20760 (K8Z38_20710) | - | 4050324..4050491 (-) | 168 | WP_000717826.1 | DUF3954 domain-containing protein | - |
| K8Z38_RS20765 (K8Z38_20715) | - | 4050511..4050870 (-) | 360 | WP_021728087.1 | hypothetical protein | - |
| K8Z38_RS20770 (K8Z38_20720) | abrB | 4050863..4051141 (-) | 279 | WP_021728995.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| K8Z38_RS20775 (K8Z38_20725) | - | 4051158..4051352 (-) | 195 | WP_021727623.1 | hypothetical protein | - |
| K8Z38_RS20780 (K8Z38_20730) | - | 4051368..4052171 (-) | 804 | WP_021727624.1 | ATP-binding protein | - |
| K8Z38_RS20785 (K8Z38_20735) | - | 4052140..4052952 (-) | 813 | WP_021727625.1 | phage replisome organizer N-terminal domain-containing protein | - |
| K8Z38_RS20790 (K8Z38_20740) | - | 4052958..4053134 (-) | 177 | WP_021727626.1 | hypothetical protein | - |
| K8Z38_RS20795 (K8Z38_20745) | - | 4053164..4053328 (-) | 165 | WP_021727627.1 | hypothetical protein | - |
| K8Z38_RS20800 (K8Z38_20750) | - | 4053341..4053601 (-) | 261 | WP_021727628.1 | hypothetical protein | - |
| K8Z38_RS20805 (K8Z38_20755) | - | 4053640..4054362 (-) | 723 | WP_021727629.1 | ORF6C domain-containing protein | - |
| K8Z38_RS20810 (K8Z38_20760) | - | 4054449..4054643 (-) | 195 | WP_021727630.1 | helix-turn-helix domain-containing protein | - |
| K8Z38_RS20815 (K8Z38_20765) | - | 4054839..4055198 (+) | 360 | WP_021727631.1 | helix-turn-helix domain-containing protein | - |
| K8Z38_RS35010 | - | 4055234..4055356 (-) | 123 | WP_021727632.1 | hypothetical protein | - |
| K8Z38_RS20820 (K8Z38_20770) | - | 4055523..4055669 (-) | 147 | WP_021727633.1 | hypothetical protein | - |
| K8Z38_RS20825 (K8Z38_20775) | - | 4055710..4056861 (-) | 1152 | WP_021727634.1 | AimR family lysis-lysogeny pheromone receptor | - |
| K8Z38_RS20830 (K8Z38_20780) | - | 4057392..4057736 (+) | 345 | WP_021727635.1 | helix-turn-helix domain-containing protein | - |
| K8Z38_RS20835 (K8Z38_20785) | - | 4057939..4059108 (+) | 1170 | WP_021727636.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10030.64 Da Isoelectric Point: 8.0497
>NTDB_id=604843 K8Z38_RS20770 WP_021728995.1 4050863..4051141(-) (abrB) [Bacillus thuringiensis strain GC-91]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENIVLRKQDKSCFVTGKVPDSNIELLGGRMFLSKEGALEL
LNSLEKSVKEHG
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENIVLRKQDKSCFVTGKVPDSNIELLGGRMFLSKEGALEL
LNSLEKSVKEHG
Nucleotide
Download Length: 279 bp
>NTDB_id=604843 K8Z38_RS20770 WP_021728995.1 4050863..4051141(-) (abrB) [Bacillus thuringiensis strain GC-91]
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACAGGATAAGTCATGCTTTG
TTACGGGTAAAGTACCTGATTCCAACATCGAATTGTTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGGGCACTTGAGTTA
CTCAACTCTCTTGAAAAGAGTGTGAAGGAACATGGCTAA
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACAGGATAAGTCATGCTTTG
TTACGGGTAAAGTACCTGATTCCAACATCGAATTGTTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGGGCACTTGAGTTA
CTCAACTCTCTTGAAAAGAGTGTGAAGGAACATGGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
53.846 |
98.913 |
0.533 |