Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | K8Z39_RS09430 | Genome accession | NZ_CP083085 |
| Coordinates | 1703246..1703524 (+) | Length | 92 a.a. |
| NCBI ID | WP_021728995.1 | Uniprot ID | A0A9X6Q7R2 |
| Organism | Bacillus thuringiensis strain B401 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1693799..1726476 | 1703246..1703524 | within | 0 |
| IS/Tn | 1704029..1705258 | 1703246..1703524 | flank | 505 |
Gene organization within MGE regions
Location: 1693799..1726476
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K8Z39_RS09345 (K8Z39_09340) | comGC | 1693933..1694232 (+) | 300 | WP_001178686.1 | competence type IV pilus major pilin ComGC | - |
| K8Z39_RS09350 (K8Z39_09345) | comGD | 1694229..1694684 (+) | 456 | WP_000813142.1 | competence type IV pilus minor pilin ComGD | - |
| K8Z39_RS09355 (K8Z39_09350) | - | 1694677..1694979 (+) | 303 | WP_000829473.1 | hypothetical protein | - |
| K8Z39_RS09360 (K8Z39_09355) | - | 1694949..1695131 (+) | 183 | Protein_1790 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
| K8Z39_RS09365 (K8Z39_09360) | - | 1695279..1696448 (-) | 1170 | WP_021727636.1 | site-specific integrase | - |
| K8Z39_RS09370 (K8Z39_09365) | - | 1696651..1696995 (-) | 345 | WP_021727635.1 | helix-turn-helix transcriptional regulator | - |
| K8Z39_RS09375 (K8Z39_09370) | - | 1697526..1698677 (+) | 1152 | WP_021727634.1 | AimR family lysis-lysogeny pheromone receptor | - |
| K8Z39_RS09380 (K8Z39_09375) | - | 1698718..1698864 (+) | 147 | WP_021727633.1 | hypothetical protein | - |
| K8Z39_RS35520 | - | 1699031..1699153 (+) | 123 | WP_021727632.1 | hypothetical protein | - |
| K8Z39_RS09385 (K8Z39_09380) | - | 1699189..1699548 (-) | 360 | WP_021727631.1 | helix-turn-helix transcriptional regulator | - |
| K8Z39_RS09390 (K8Z39_09385) | - | 1699744..1699938 (+) | 195 | WP_021727630.1 | helix-turn-helix transcriptional regulator | - |
| K8Z39_RS09395 (K8Z39_09390) | - | 1700025..1700747 (+) | 723 | WP_021727629.1 | ORF6C domain-containing protein | - |
| K8Z39_RS09400 (K8Z39_09395) | - | 1700786..1701046 (+) | 261 | WP_021727628.1 | hypothetical protein | - |
| K8Z39_RS09405 (K8Z39_09400) | - | 1701059..1701223 (+) | 165 | WP_021727627.1 | hypothetical protein | - |
| K8Z39_RS09410 (K8Z39_09405) | - | 1701253..1701429 (+) | 177 | WP_021727626.1 | hypothetical protein | - |
| K8Z39_RS09415 (K8Z39_09410) | - | 1701435..1702247 (+) | 813 | WP_021727625.1 | phage replisome organizer N-terminal domain-containing protein | - |
| K8Z39_RS09420 (K8Z39_09415) | - | 1702216..1703019 (+) | 804 | WP_021727624.1 | ATP-binding protein | - |
| K8Z39_RS09425 (K8Z39_09420) | - | 1703035..1703229 (+) | 195 | WP_021727623.1 | hypothetical protein | - |
| K8Z39_RS09430 (K8Z39_09425) | abrB | 1703246..1703524 (+) | 279 | WP_021728995.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| K8Z39_RS09435 (K8Z39_09430) | - | 1703517..1703876 (+) | 360 | WP_021728087.1 | hypothetical protein | - |
| K8Z39_RS09440 (K8Z39_09435) | - | 1704029..1705258 (-) | 1230 | WP_021728073.1 | IS110 family transposase | - |
| K8Z39_RS09445 (K8Z39_09440) | - | 1705624..1705791 (+) | 168 | WP_000717826.1 | DUF3954 domain-containing protein | - |
| K8Z39_RS09450 (K8Z39_09445) | - | 1705817..1706068 (+) | 252 | WP_000109496.1 | hypothetical protein | - |
| K8Z39_RS09455 (K8Z39_09450) | - | 1706088..1706543 (+) | 456 | WP_021728086.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| K8Z39_RS09460 (K8Z39_09455) | - | 1706714..1707121 (+) | 408 | WP_016090376.1 | hypothetical protein | - |
| K8Z39_RS09465 (K8Z39_09460) | - | 1707713..1707910 (+) | 198 | WP_021727602.1 | hypothetical protein | - |
| K8Z39_RS09470 (K8Z39_09465) | - | 1707949..1708131 (+) | 183 | WP_021727601.1 | hypothetical protein | - |
| K8Z39_RS09475 (K8Z39_09470) | - | 1708670..1708912 (+) | 243 | WP_021727600.1 | hypothetical protein | - |
| K8Z39_RS09480 (K8Z39_09475) | - | 1709172..1709342 (+) | 171 | WP_021727599.1 | hypothetical protein | - |
| K8Z39_RS09485 (K8Z39_09480) | - | 1709363..1709833 (+) | 471 | WP_021727598.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| K8Z39_RS09490 (K8Z39_09485) | - | 1709830..1710372 (+) | 543 | WP_021727597.1 | tyrosine-type recombinase/integrase | - |
| K8Z39_RS09495 (K8Z39_09490) | - | 1710976..1711167 (+) | 192 | WP_021727596.1 | hypothetical protein | - |
| K8Z39_RS09500 (K8Z39_09495) | - | 1711167..1711661 (+) | 495 | WP_021727595.1 | hypothetical protein | - |
| K8Z39_RS09505 (K8Z39_09500) | - | 1711645..1711875 (+) | 231 | WP_021727594.1 | hypothetical protein | - |
| K8Z39_RS09510 (K8Z39_09505) | - | 1711882..1712178 (+) | 297 | WP_021727593.1 | hypothetical protein | - |
| K8Z39_RS09515 (K8Z39_09510) | - | 1712370..1712615 (+) | 246 | WP_021727591.1 | hypothetical protein | - |
| K8Z39_RS09520 (K8Z39_09515) | - | 1712654..1712923 (+) | 270 | WP_228220125.1 | HNH endonuclease signature motif containing protein | - |
| K8Z39_RS09525 (K8Z39_09520) | - | 1712926..1713234 (+) | 309 | WP_021727589.1 | hypothetical protein | - |
| K8Z39_RS09530 (K8Z39_09525) | - | 1713340..1713651 (+) | 312 | WP_021727588.1 | hypothetical protein | - |
| K8Z39_RS09535 (K8Z39_09530) | - | 1713638..1715290 (+) | 1653 | WP_021727587.1 | terminase TerL endonuclease subunit | - |
| K8Z39_RS09540 (K8Z39_09535) | - | 1715304..1716470 (+) | 1167 | WP_021727586.1 | phage portal protein | - |
| K8Z39_RS09545 (K8Z39_09540) | - | 1716457..1717173 (+) | 717 | WP_021727585.1 | head maturation protease, ClpP-related | - |
| K8Z39_RS09550 (K8Z39_09545) | - | 1717216..1718379 (+) | 1164 | WP_021727584.1 | phage major capsid protein | - |
| K8Z39_RS09555 (K8Z39_09550) | - | 1718417..1718527 (+) | 111 | Protein_1830 | hypothetical protein | - |
| K8Z39_RS09560 (K8Z39_09555) | - | 1718520..1718816 (+) | 297 | WP_021727582.1 | hypothetical protein | - |
| K8Z39_RS09565 (K8Z39_09560) | - | 1718797..1719153 (+) | 357 | WP_021727581.1 | phage head closure protein | - |
| K8Z39_RS09570 (K8Z39_09565) | - | 1719146..1719547 (+) | 402 | WP_021727580.1 | hypothetical protein | - |
| K8Z39_RS09575 (K8Z39_09570) | - | 1719534..1719962 (+) | 429 | WP_228225059.1 | hypothetical protein | - |
| K8Z39_RS09580 (K8Z39_09575) | - | 1719963..1720547 (+) | 585 | WP_021727578.1 | major tail protein B | - |
| K8Z39_RS09585 (K8Z39_09580) | - | 1720619..1721080 (+) | 462 | WP_021727577.1 | hypothetical protein | - |
| K8Z39_RS09590 (K8Z39_09585) | - | 1721259..1722839 (+) | 1581 | WP_021727576.1 | hypothetical protein | - |
| K8Z39_RS09595 (K8Z39_09590) | - | 1723347..1726187 (+) | 2841 | WP_228220127.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10030.64 Da Isoelectric Point: 8.0497
>NTDB_id=604580 K8Z39_RS09430 WP_021728995.1 1703246..1703524(+) (abrB) [Bacillus thuringiensis strain B401]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENIVLRKQDKSCFVTGKVPDSNIELLGGRMFLSKEGALEL
LNSLEKSVKEHG
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENIVLRKQDKSCFVTGKVPDSNIELLGGRMFLSKEGALEL
LNSLEKSVKEHG
Nucleotide
Download Length: 279 bp
>NTDB_id=604580 K8Z39_RS09430 WP_021728995.1 1703246..1703524(+) (abrB) [Bacillus thuringiensis strain B401]
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACAGGATAAGTCATGCTTTG
TTACGGGTAAAGTACCTGATTCCAACATCGAATTGTTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGGGCACTTGAGTTA
CTCAACTCTCTTGAAAAGAGTGTGAAGGAACATGGCTAA
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACAGGATAAGTCATGCTTTG
TTACGGGTAAAGTACCTGATTCCAACATCGAATTGTTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGGGCACTTGAGTTA
CTCAACTCTCTTGAAAAGAGTGTGAAGGAACATGGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
53.846 |
98.913 |
0.533 |