Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   K8B76_RS02600 Genome accession   NZ_CP082820
Coordinates   538263..538412 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain SCAID PHRX1-2021     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 533263..543412
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K8B76_RS02575 (K8B76_02575) blpC 533549..533677 (-) 129 WP_000358815.1 quorum-sensing system pheromone BlpC -
  K8B76_RS02580 (K8B76_02580) - 533734..535095 (-) 1362 WP_001069072.1 bacteriocin secretion accessory protein -
  K8B76_RS02585 (K8B76_02585) blpA 535106..537264 (-) 2159 Protein_519 peptide cleavage/export ABC transporter BlpA -
  K8B76_RS02590 (K8B76_02590) blpM 537546..537800 (+) 255 WP_001093256.1 two-peptide bacteriocin subunit BlpM -
  K8B76_RS02595 (K8B76_02595) blpN 537816..538019 (+) 204 WP_001099490.1 two-peptide bacteriocin subunit BlpN -
  K8B76_RS02600 (K8B76_02600) cipB 538263..538412 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  K8B76_RS11080 - 538448..538513 (+) 66 Protein_523 ComC/BlpC family peptide pheromone/bacteriocin -
  K8B76_RS02605 (K8B76_02605) - 538516..538635 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  K8B76_RS02610 (K8B76_02610) - 538933..539097 (+) 165 WP_000727117.1 hypothetical protein -
  K8B76_RS02615 (K8B76_02615) - 539159..539497 (+) 339 WP_088804618.1 immunity protein -
  K8B76_RS02620 (K8B76_02620) - 540126..540509 (+) 384 WP_000877381.1 hypothetical protein -
  K8B76_RS02625 (K8B76_02625) - 540561..541250 (+) 690 WP_000760520.1 CPBP family intramembrane glutamic endopeptidase -
  K8B76_RS02630 (K8B76_02630) blpZ 541292..541540 (+) 249 WP_000276501.1 immunity protein BlpZ -
  K8B76_RS02635 (K8B76_02635) - 541570..542181 (+) 612 WP_000394036.1 CPBP family intramembrane glutamic endopeptidase -
  K8B76_RS02640 (K8B76_02640) ccrZ 542342..543136 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=602526 K8B76_RS02600 WP_001809846.1 538263..538412(+) (cipB) [Streptococcus pneumoniae strain SCAID PHRX1-2021]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=602526 K8B76_RS02600 WP_001809846.1 538263..538412(+) (cipB) [Streptococcus pneumoniae strain SCAID PHRX1-2021]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531