Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   M5C73_RS11615 Genome accession   NZ_CP098790
Coordinates   2328137..2328421 (-) Length   94 a.a.
NCBI ID   WP_017865155.1    Uniprot ID   -
Organism   Lactococcus lactis strain WiKim0124     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2323137..2333421
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M5C73_RS11585 (M5C73_11585) - 2323579..2323956 (-) 378 WP_033900715.1 pyridoxamine 5'-phosphate oxidase family protein -
  M5C73_RS11590 (M5C73_11590) - 2324160..2325026 (+) 867 WP_058204413.1 RluA family pseudouridine synthase -
  M5C73_RS11595 (M5C73_11595) - 2325064..2325873 (-) 810 WP_014570791.1 metal ABC transporter permease -
  M5C73_RS11600 (M5C73_11600) - 2325866..2326603 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  M5C73_RS11605 (M5C73_11605) - 2326780..2327622 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  M5C73_RS11610 (M5C73_11610) - 2327619..2328056 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  M5C73_RS11615 (M5C73_11615) comGG 2328137..2328421 (-) 285 WP_017865155.1 competence type IV pilus minor pilin ComGG Machinery gene
  M5C73_RS11620 (M5C73_11620) comGF 2328460..2328885 (-) 426 WP_161935022.1 competence type IV pilus minor pilin ComGF Machinery gene
  M5C73_RS11625 (M5C73_11625) comGE 2328869..2329165 (-) 297 WP_250354455.1 competence type IV pilus minor pilin ComGE Machinery gene
  M5C73_RS11630 (M5C73_11630) comGD 2329137..2329553 (-) 417 WP_032941843.1 competence type IV pilus minor pilin ComGD Machinery gene
  M5C73_RS11635 (M5C73_11635) comGC 2329528..2329911 (-) 384 WP_080735951.1 competence type IV pilus major pilin ComGC Machinery gene
  M5C73_RS11640 (M5C73_11640) comGB 2329925..2330944 (-) 1020 WP_047206974.1 competence type IV pilus assembly protein ComGB Machinery gene
  M5C73_RS11645 (M5C73_11645) comGA 2330892..2331830 (-) 939 WP_058203709.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10782.04 Da        Isoelectric Point: 5.5720

>NTDB_id=601192 M5C73_RS11615 WP_017865155.1 2328137..2328421(-) (comGG) [Lactococcus lactis strain WiKim0124]
MFSMFLQFYLQRQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=601192 M5C73_RS11615 WP_017865155.1 2328137..2328421(-) (comGG) [Lactococcus lactis strain WiKim0124]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGCAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

60.215

98.936

0.596