Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   BAJP3144_RS12605 Genome accession   NZ_CP082283
Coordinates   2590375..2590641 (-) Length   88 a.a.
NCBI ID   WP_050496152.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain JP3144     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2585375..2595641
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAJP3144_RS12555 (BAJP3144_12555) sinR 2585538..2585873 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BAJP3144_RS12560 (BAJP3144_12560) tasA 2585921..2586706 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BAJP3144_RS12565 (BAJP3144_12565) sipW 2586771..2587355 (-) 585 WP_012117977.1 signal peptidase I SipW -
  BAJP3144_RS12570 (BAJP3144_12570) tapA 2587327..2587998 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  BAJP3144_RS12575 (BAJP3144_12575) - 2588257..2588586 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BAJP3144_RS12580 (BAJP3144_12580) - 2588627..2588806 (-) 180 WP_003153093.1 YqzE family protein -
  BAJP3144_RS12585 (BAJP3144_12585) comGG 2588863..2589240 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAJP3144_RS12590 (BAJP3144_12590) comGF 2589241..2589636 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  BAJP3144_RS12595 (BAJP3144_12595) comGE 2589650..2589964 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  BAJP3144_RS12600 (BAJP3144_12600) comGD 2589948..2590385 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  BAJP3144_RS12605 (BAJP3144_12605) comGC 2590375..2590641 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  BAJP3144_RS12610 (BAJP3144_12610) comGB 2590688..2591725 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  BAJP3144_RS12615 (BAJP3144_12615) comGA 2591712..2592782 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  BAJP3144_RS12620 (BAJP3144_12620) - 2592975..2593925 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  BAJP3144_RS12625 (BAJP3144_12625) - 2594071..2595372 (+) 1302 WP_021494315.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9740.36 Da        Isoelectric Point: 6.4456

>NTDB_id=601040 BAJP3144_RS12605 WP_050496152.1 2590375..2590641(-) (comGC) [Bacillus amyloliquefaciens strain JP3144]
MLIVLFIVSILLLITIPNVTKHNQSIQRKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=601040 BAJP3144_RS12605 WP_050496152.1 2590375..2590641(-) (comGC) [Bacillus amyloliquefaciens strain JP3144]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCGTAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

73.611

81.818

0.602