Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   BAJP3144_RS12550 Genome accession   NZ_CP082283
Coordinates   2585331..2585504 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus amyloliquefaciens strain JP3144     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2580331..2590504
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAJP3144_RS12535 (BAJP3144_12535) gcvT 2581144..2582244 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  BAJP3144_RS12540 (BAJP3144_12540) - 2582668..2584338 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  BAJP3144_RS12545 (BAJP3144_12545) - 2584360..2585154 (+) 795 WP_014418368.1 YqhG family protein -
  BAJP3144_RS12550 (BAJP3144_12550) sinI 2585331..2585504 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  BAJP3144_RS12555 (BAJP3144_12555) sinR 2585538..2585873 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BAJP3144_RS12560 (BAJP3144_12560) tasA 2585921..2586706 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BAJP3144_RS12565 (BAJP3144_12565) sipW 2586771..2587355 (-) 585 WP_012117977.1 signal peptidase I SipW -
  BAJP3144_RS12570 (BAJP3144_12570) tapA 2587327..2587998 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  BAJP3144_RS12575 (BAJP3144_12575) - 2588257..2588586 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BAJP3144_RS12580 (BAJP3144_12580) - 2588627..2588806 (-) 180 WP_003153093.1 YqzE family protein -
  BAJP3144_RS12585 (BAJP3144_12585) comGG 2588863..2589240 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAJP3144_RS12590 (BAJP3144_12590) comGF 2589241..2589636 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  BAJP3144_RS12595 (BAJP3144_12595) comGE 2589650..2589964 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  BAJP3144_RS12600 (BAJP3144_12600) comGD 2589948..2590385 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=601035 BAJP3144_RS12550 WP_014418369.1 2585331..2585504(+) (sinI) [Bacillus amyloliquefaciens strain JP3144]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=601035 BAJP3144_RS12550 WP_014418369.1 2585331..2585504(+) (sinI) [Bacillus amyloliquefaciens strain JP3144]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719