Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   K7B13_RS11850 Genome accession   NZ_CP082278
Coordinates   2356373..2356546 (+) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens strain 35M     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2351373..2361546
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K7B13_RS11835 (K7B13_11835) gcvT 2352184..2353284 (-) 1101 WP_115997629.1 glycine cleavage system aminomethyltransferase GcvT -
  K7B13_RS11840 (K7B13_11840) - 2353708..2355378 (+) 1671 WP_065981874.1 DEAD/DEAH box helicase -
  K7B13_RS11845 (K7B13_11845) - 2355399..2356193 (+) 795 WP_065981875.1 YqhG family protein -
  K7B13_RS11850 (K7B13_11850) sinI 2356373..2356546 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  K7B13_RS11855 (K7B13_11855) sinR 2356580..2356915 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  K7B13_RS11860 (K7B13_11860) tasA 2356963..2357748 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  K7B13_RS11865 (K7B13_11865) sipW 2357813..2358397 (-) 585 WP_212098460.1 signal peptidase I SipW -
  K7B13_RS11870 (K7B13_11870) tapA 2358369..2359040 (-) 672 WP_212098462.1 amyloid fiber anchoring/assembly protein TapA -
  K7B13_RS11875 (K7B13_11875) - 2359298..2359627 (+) 330 WP_045510605.1 DUF3889 domain-containing protein -
  K7B13_RS11880 (K7B13_11880) - 2359668..2359847 (-) 180 WP_016938971.1 YqzE family protein -
  K7B13_RS11885 (K7B13_11885) comGG 2359904..2360281 (-) 378 WP_212098464.1 competence type IV pilus minor pilin ComGG Machinery gene
  K7B13_RS11890 (K7B13_11890) comGF 2360283..2360678 (-) 396 WP_212101733.1 competence type IV pilus minor pilin ComGF -
  K7B13_RS11895 (K7B13_11895) - 2360692..2360958 (-) 267 WP_258415241.1 type II secretion system protein -
  K7B13_RS11900 (K7B13_11900) comGD 2360990..2361427 (-) 438 WP_045510590.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=600863 K7B13_RS11850 WP_013352860.1 2356373..2356546(+) (sinI) [Bacillus amyloliquefaciens strain 35M]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=600863 K7B13_RS11850 WP_013352860.1 2356373..2356546(+) (sinI) [Bacillus amyloliquefaciens strain 35M]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684