Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   K6973_RS05185 Genome accession   NZ_CP082206
Coordinates   998335..998517 (+) Length   60 a.a.
NCBI ID   WP_222819677.1    Uniprot ID   -
Organism   Streptococcus dysgalactiae strain DY107     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 943998..998517 998335..998517 within 0


Gene organization within MGE regions


Location: 943998..998517
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6973_RS04815 (K6973_04815) - 944103..945629 (-) 1527 WP_218655297.1 helix-turn-helix domain-containing protein -
  K6973_RS04820 (K6973_04820) - 946080..946592 (+) 513 WP_222819633.1 hypothetical protein -
  K6973_RS04825 (K6973_04825) - 946558..946899 (+) 342 WP_222819634.1 hypothetical protein -
  K6973_RS04830 (K6973_04830) - 947041..948052 (-) 1012 Protein_909 IS3 family transposase -
  K6973_RS04835 (K6973_04835) - 948281..949558 (-) 1278 WP_138125397.1 hydroxymethylglutaryl-CoA reductase, degradative -
  K6973_RS04840 (K6973_04840) - 949539..950720 (-) 1182 WP_138125399.1 hydroxymethylglutaryl-CoA synthase -
  K6973_RS04845 (K6973_04845) - 950938..951777 (+) 840 WP_129555803.1 thymidylate synthase -
  K6973_RS04850 (K6973_04850) - 951858..952355 (+) 498 WP_065957460.1 dihydrofolate reductase -
  K6973_RS04855 (K6973_04855) - 952375..952545 (+) 171 WP_003054200.1 hypothetical protein -
  K6973_RS04860 (K6973_04860) clpX 952661..953890 (+) 1230 WP_003054192.1 ATP-dependent Clp protease ATP-binding subunit ClpX Regulator
  K6973_RS04865 (K6973_04865) yihA 953900..954499 (+) 600 WP_138125401.1 ribosome biogenesis GTP-binding protein YihA/YsxC -
  K6973_RS04870 (K6973_04870) - 954643..955386 (+) 744 WP_138125403.1 hypothetical protein -
  K6973_RS04875 (K6973_04875) clpC 955443..957542 (-) 2100 WP_138125405.1 ATP-dependent Clp protease ATP-binding subunit Regulator
  K6973_RS04880 (K6973_04880) - 958024..959220 (-) 1197 WP_222819635.1 site-specific integrase -
  K6973_RS04885 (K6973_04885) - 959399..959992 (-) 594 WP_222819636.1 HIRAN domain-containing protein -
  K6973_RS04890 (K6973_04890) - 960004..960351 (-) 348 WP_222819637.1 ImmA/IrrE family metallo-endopeptidase -
  K6973_RS04895 (K6973_04895) - 960356..960712 (-) 357 WP_222819714.1 helix-turn-helix transcriptional regulator -
  K6973_RS04900 (K6973_04900) - 961000..961164 (+) 165 WP_015984783.1 hypothetical protein -
  K6973_RS04905 (K6973_04905) - 961206..961409 (+) 204 WP_015984784.1 hypothetical protein -
  K6973_RS11285 - 961411..961545 (+) 135 WP_261987967.1 hypothetical protein -
  K6973_RS04910 (K6973_04910) - 961542..962297 (+) 756 WP_222819638.1 ORF6C domain-containing protein -
  K6973_RS04915 (K6973_04915) - 962371..962628 (+) 258 WP_066028353.1 hypothetical protein -
  K6973_RS04920 (K6973_04920) - 962766..962954 (+) 189 WP_032460866.1 hypothetical protein -
  K6973_RS04925 (K6973_04925) dnaB 962941..964281 (+) 1341 WP_222819639.1 replicative DNA helicase -
  K6973_RS04930 (K6973_04930) - 964274..965035 (+) 762 WP_222819640.1 conserved phage C-terminal domain-containing protein -
  K6973_RS04935 (K6973_04935) - 965036..965857 (+) 822 WP_222819641.1 ATP-binding protein -
  K6973_RS04940 (K6973_04940) - 965857..966084 (+) 228 WP_222819642.1 hypothetical protein -
  K6973_RS04945 (K6973_04945) - 966098..966304 (+) 207 WP_155782846.1 hypothetical protein -
  K6973_RS04950 (K6973_04950) - 966315..966581 (+) 267 WP_222819643.1 hypothetical protein -
  K6973_RS04955 (K6973_04955) dcm 966584..967222 (+) 639 WP_222819644.1 DNA (cytosine-5-)-methyltransferase -
  K6973_RS04960 (K6973_04960) - 967210..967365 (+) 156 WP_160113531.1 hypothetical protein -
  K6973_RS04965 (K6973_04965) - 967346..967957 (+) 612 WP_222819645.1 DNA cytosine methyltransferase -
  K6973_RS04970 (K6973_04970) - 967947..968480 (+) 534 WP_222819646.1 DUF1642 domain-containing protein -
  K6973_RS04975 (K6973_04975) ssbA 968685..969077 (+) 393 WP_222819647.1 single-stranded DNA-binding protein Machinery gene
  K6973_RS04980 (K6973_04980) - 969091..969369 (+) 279 WP_029713970.1 hypothetical protein -
  K6973_RS04985 (K6973_04985) - 969366..969707 (+) 342 WP_222819648.1 helix-turn-helix transcriptional regulator -
  K6973_RS04990 (K6973_04990) - 969830..970657 (+) 828 WP_222819649.1 prohibitin family protein -
  K6973_RS04995 (K6973_04995) - 970672..971073 (+) 402 WP_011017373.1 hypothetical protein -
  K6973_RS05000 (K6973_05000) - 971233..971808 (+) 576 WP_011054435.1 site-specific integrase -
  K6973_RS05005 (K6973_05005) - 971960..972382 (+) 423 WP_222819650.1 hypothetical protein -
  K6973_RS05010 (K6973_05010) - 972363..972749 (+) 387 WP_222819651.1 hypothetical protein -
  K6973_RS05015 (K6973_05015) - 972742..973047 (+) 306 WP_222819652.1 HNH endonuclease signature motif containing protein -
  K6973_RS05020 (K6973_05020) - 973190..973507 (+) 318 WP_015984806.1 P27 family phage terminase small subunit -
  K6973_RS05025 (K6973_05025) - 973520..975250 (+) 1731 WP_222819653.1 terminase large subunit -
  K6973_RS05030 (K6973_05030) - 975250..975465 (+) 216 WP_261987968.1 hypothetical protein -
  K6973_RS05035 (K6973_05035) - 975640..976827 (+) 1188 WP_222819655.1 phage portal protein -
  K6973_RS05040 (K6973_05040) - 976808..977614 (+) 807 WP_222819656.1 head maturation protease, ClpP-related -
  K6973_RS05045 (K6973_05045) - 977631..978764 (+) 1134 WP_222819657.1 phage major capsid protein -
  K6973_RS05050 (K6973_05050) - 978778..978951 (+) 174 WP_167320972.1 hypothetical protein -
  K6973_RS05055 (K6973_05055) - 978951..979259 (+) 309 WP_222819658.1 hypothetical protein -
  K6973_RS05060 (K6973_05060) - 979252..979614 (+) 363 WP_222819659.1 phage head-tail adapter protein -
  K6973_RS05065 (K6973_05065) - 979616..980014 (+) 399 WP_022554764.1 hypothetical protein -
  K6973_RS05070 (K6973_05070) - 980007..980387 (+) 381 WP_222819660.1 hypothetical protein -
  K6973_RS05075 (K6973_05075) - 980399..980983 (+) 585 WP_222819661.1 major tail protein -
  K6973_RS05080 (K6973_05080) - 981079..981381 (+) 303 WP_222819662.1 hypothetical protein -
  K6973_RS05085 (K6973_05085) - 981396..981563 (+) 168 WP_156888861.1 hypothetical protein -
  K6973_RS05090 (K6973_05090) - 981607..985707 (+) 4101 WP_222819663.1 phage tail tape measure protein -
  K6973_RS05095 (K6973_05095) - 985720..986490 (+) 771 WP_222819664.1 distal tail protein Dit -
  K6973_RS05100 (K6973_05100) - 986487..988538 (+) 2052 WP_222819665.1 phage tail spike protein -
  K6973_RS11450 (K6973_05105) - 988538..989407 (+) 870 WP_222819666.1 collagen-like protein -
  K6973_RS05110 (K6973_05110) - 989394..989987 (+) 594 WP_222819667.1 hypothetical protein -
  K6973_RS05115 (K6973_05115) - 989998..991902 (+) 1905 WP_222819668.1 gp58-like family protein -
  K6973_RS05120 (K6973_05120) - 991911..992342 (+) 432 WP_222819669.1 DUF1617 family protein -
  K6973_RS05125 (K6973_05125) - 992345..992956 (+) 612 WP_050317156.1 hypothetical protein -
  K6973_RS05130 (K6973_05130) - 992967..993260 (+) 294 WP_222819670.1 hypothetical protein -
  K6973_RS05135 (K6973_05135) - 993261..993446 (+) 186 WP_222819671.1 holin -
  K6973_RS05140 (K6973_05140) - 993558..994775 (+) 1218 WP_222819672.1 peptidoglycan amidohydrolase family protein -
  K6973_RS05145 (K6973_05145) - 994838..995647 (-) 810 WP_222819673.1 recombinase family protein -
  K6973_RS05150 (K6973_05150) - 995769..996020 (-) 252 WP_222819674.1 hypothetical protein -
  K6973_RS05155 (K6973_05155) - 996161..996307 (-) 147 WP_164406938.1 hypothetical protein -
  K6973_RS05160 (K6973_05160) - 996461..996670 (+) 210 WP_011054450.1 helix-turn-helix transcriptional regulator -
  K6973_RS05165 (K6973_05165) - 996852..997142 (-) 291 WP_222819675.1 hypothetical protein -
  K6973_RS05170 (K6973_05170) - 997158..997343 (-) 186 WP_046176801.1 helix-turn-helix transcriptional regulator -
  K6973_RS05175 (K6973_05175) - 997340..997819 (-) 480 WP_222819676.1 hypothetical protein -
  K6973_RS05180 (K6973_05180) - 997852..998160 (-) 309 WP_165746035.1 hypothetical protein -
  K6973_RS05185 (K6973_05185) prx 998335..998517 (+) 183 WP_222819677.1 Paratox Regulator

Sequence


Protein


Download         Length: 60 a.a.        Molecular weight: 6975.90 Da        Isoelectric Point: 4.0338

>NTDB_id=600108 K6973_RS05185 WP_222819677.1 998335..998517(+) (prx) [Streptococcus dysgalactiae strain DY107]
MLTYDEFKQAIDDGYITADTVMIVRKDGQIFDYALPGEPVRPWEVVTEERVEAVLRELDK

Nucleotide


Download         Length: 183 bp        

>NTDB_id=600108 K6973_RS05185 WP_222819677.1 998335..998517(+) (prx) [Streptococcus dysgalactiae strain DY107]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGCGTTGCCTGGTGAGCCTGTGAGACCGTGGGAGGTTGTGACAGAGGAGAGGGTGGAAGCAG
TGCTGAGGGAATTAGACAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

83.333

100

0.833

  prx Streptococcus pyogenes MGAS315

78.333

100

0.783

  prx Streptococcus pyogenes MGAS315

75

100

0.75

  prx Streptococcus pyogenes MGAS8232

73.333

100

0.733

  prx Streptococcus pyogenes MGAS315

73.333

100

0.733

  prx Streptococcus pyogenes MGAS315

82.927

68.333

0.567

  prx Streptococcus pyogenes MGAS315

70.732

68.333

0.483