Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | K6973_RS05185 | Genome accession | NZ_CP082206 |
| Coordinates | 998335..998517 (+) | Length | 60 a.a. |
| NCBI ID | WP_222819677.1 | Uniprot ID | - |
| Organism | Streptococcus dysgalactiae strain DY107 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 943998..998517 | 998335..998517 | within | 0 |
Gene organization within MGE regions
Location: 943998..998517
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K6973_RS04815 (K6973_04815) | - | 944103..945629 (-) | 1527 | WP_218655297.1 | helix-turn-helix domain-containing protein | - |
| K6973_RS04820 (K6973_04820) | - | 946080..946592 (+) | 513 | WP_222819633.1 | hypothetical protein | - |
| K6973_RS04825 (K6973_04825) | - | 946558..946899 (+) | 342 | WP_222819634.1 | hypothetical protein | - |
| K6973_RS04830 (K6973_04830) | - | 947041..948052 (-) | 1012 | Protein_909 | IS3 family transposase | - |
| K6973_RS04835 (K6973_04835) | - | 948281..949558 (-) | 1278 | WP_138125397.1 | hydroxymethylglutaryl-CoA reductase, degradative | - |
| K6973_RS04840 (K6973_04840) | - | 949539..950720 (-) | 1182 | WP_138125399.1 | hydroxymethylglutaryl-CoA synthase | - |
| K6973_RS04845 (K6973_04845) | - | 950938..951777 (+) | 840 | WP_129555803.1 | thymidylate synthase | - |
| K6973_RS04850 (K6973_04850) | - | 951858..952355 (+) | 498 | WP_065957460.1 | dihydrofolate reductase | - |
| K6973_RS04855 (K6973_04855) | - | 952375..952545 (+) | 171 | WP_003054200.1 | hypothetical protein | - |
| K6973_RS04860 (K6973_04860) | clpX | 952661..953890 (+) | 1230 | WP_003054192.1 | ATP-dependent Clp protease ATP-binding subunit ClpX | Regulator |
| K6973_RS04865 (K6973_04865) | yihA | 953900..954499 (+) | 600 | WP_138125401.1 | ribosome biogenesis GTP-binding protein YihA/YsxC | - |
| K6973_RS04870 (K6973_04870) | - | 954643..955386 (+) | 744 | WP_138125403.1 | hypothetical protein | - |
| K6973_RS04875 (K6973_04875) | clpC | 955443..957542 (-) | 2100 | WP_138125405.1 | ATP-dependent Clp protease ATP-binding subunit | Regulator |
| K6973_RS04880 (K6973_04880) | - | 958024..959220 (-) | 1197 | WP_222819635.1 | site-specific integrase | - |
| K6973_RS04885 (K6973_04885) | - | 959399..959992 (-) | 594 | WP_222819636.1 | HIRAN domain-containing protein | - |
| K6973_RS04890 (K6973_04890) | - | 960004..960351 (-) | 348 | WP_222819637.1 | ImmA/IrrE family metallo-endopeptidase | - |
| K6973_RS04895 (K6973_04895) | - | 960356..960712 (-) | 357 | WP_222819714.1 | helix-turn-helix transcriptional regulator | - |
| K6973_RS04900 (K6973_04900) | - | 961000..961164 (+) | 165 | WP_015984783.1 | hypothetical protein | - |
| K6973_RS04905 (K6973_04905) | - | 961206..961409 (+) | 204 | WP_015984784.1 | hypothetical protein | - |
| K6973_RS11285 | - | 961411..961545 (+) | 135 | WP_261987967.1 | hypothetical protein | - |
| K6973_RS04910 (K6973_04910) | - | 961542..962297 (+) | 756 | WP_222819638.1 | ORF6C domain-containing protein | - |
| K6973_RS04915 (K6973_04915) | - | 962371..962628 (+) | 258 | WP_066028353.1 | hypothetical protein | - |
| K6973_RS04920 (K6973_04920) | - | 962766..962954 (+) | 189 | WP_032460866.1 | hypothetical protein | - |
| K6973_RS04925 (K6973_04925) | dnaB | 962941..964281 (+) | 1341 | WP_222819639.1 | replicative DNA helicase | - |
| K6973_RS04930 (K6973_04930) | - | 964274..965035 (+) | 762 | WP_222819640.1 | conserved phage C-terminal domain-containing protein | - |
| K6973_RS04935 (K6973_04935) | - | 965036..965857 (+) | 822 | WP_222819641.1 | ATP-binding protein | - |
| K6973_RS04940 (K6973_04940) | - | 965857..966084 (+) | 228 | WP_222819642.1 | hypothetical protein | - |
| K6973_RS04945 (K6973_04945) | - | 966098..966304 (+) | 207 | WP_155782846.1 | hypothetical protein | - |
| K6973_RS04950 (K6973_04950) | - | 966315..966581 (+) | 267 | WP_222819643.1 | hypothetical protein | - |
| K6973_RS04955 (K6973_04955) | dcm | 966584..967222 (+) | 639 | WP_222819644.1 | DNA (cytosine-5-)-methyltransferase | - |
| K6973_RS04960 (K6973_04960) | - | 967210..967365 (+) | 156 | WP_160113531.1 | hypothetical protein | - |
| K6973_RS04965 (K6973_04965) | - | 967346..967957 (+) | 612 | WP_222819645.1 | DNA cytosine methyltransferase | - |
| K6973_RS04970 (K6973_04970) | - | 967947..968480 (+) | 534 | WP_222819646.1 | DUF1642 domain-containing protein | - |
| K6973_RS04975 (K6973_04975) | ssbA | 968685..969077 (+) | 393 | WP_222819647.1 | single-stranded DNA-binding protein | Machinery gene |
| K6973_RS04980 (K6973_04980) | - | 969091..969369 (+) | 279 | WP_029713970.1 | hypothetical protein | - |
| K6973_RS04985 (K6973_04985) | - | 969366..969707 (+) | 342 | WP_222819648.1 | helix-turn-helix transcriptional regulator | - |
| K6973_RS04990 (K6973_04990) | - | 969830..970657 (+) | 828 | WP_222819649.1 | prohibitin family protein | - |
| K6973_RS04995 (K6973_04995) | - | 970672..971073 (+) | 402 | WP_011017373.1 | hypothetical protein | - |
| K6973_RS05000 (K6973_05000) | - | 971233..971808 (+) | 576 | WP_011054435.1 | site-specific integrase | - |
| K6973_RS05005 (K6973_05005) | - | 971960..972382 (+) | 423 | WP_222819650.1 | hypothetical protein | - |
| K6973_RS05010 (K6973_05010) | - | 972363..972749 (+) | 387 | WP_222819651.1 | hypothetical protein | - |
| K6973_RS05015 (K6973_05015) | - | 972742..973047 (+) | 306 | WP_222819652.1 | HNH endonuclease signature motif containing protein | - |
| K6973_RS05020 (K6973_05020) | - | 973190..973507 (+) | 318 | WP_015984806.1 | P27 family phage terminase small subunit | - |
| K6973_RS05025 (K6973_05025) | - | 973520..975250 (+) | 1731 | WP_222819653.1 | terminase large subunit | - |
| K6973_RS05030 (K6973_05030) | - | 975250..975465 (+) | 216 | WP_261987968.1 | hypothetical protein | - |
| K6973_RS05035 (K6973_05035) | - | 975640..976827 (+) | 1188 | WP_222819655.1 | phage portal protein | - |
| K6973_RS05040 (K6973_05040) | - | 976808..977614 (+) | 807 | WP_222819656.1 | head maturation protease, ClpP-related | - |
| K6973_RS05045 (K6973_05045) | - | 977631..978764 (+) | 1134 | WP_222819657.1 | phage major capsid protein | - |
| K6973_RS05050 (K6973_05050) | - | 978778..978951 (+) | 174 | WP_167320972.1 | hypothetical protein | - |
| K6973_RS05055 (K6973_05055) | - | 978951..979259 (+) | 309 | WP_222819658.1 | hypothetical protein | - |
| K6973_RS05060 (K6973_05060) | - | 979252..979614 (+) | 363 | WP_222819659.1 | phage head-tail adapter protein | - |
| K6973_RS05065 (K6973_05065) | - | 979616..980014 (+) | 399 | WP_022554764.1 | hypothetical protein | - |
| K6973_RS05070 (K6973_05070) | - | 980007..980387 (+) | 381 | WP_222819660.1 | hypothetical protein | - |
| K6973_RS05075 (K6973_05075) | - | 980399..980983 (+) | 585 | WP_222819661.1 | major tail protein | - |
| K6973_RS05080 (K6973_05080) | - | 981079..981381 (+) | 303 | WP_222819662.1 | hypothetical protein | - |
| K6973_RS05085 (K6973_05085) | - | 981396..981563 (+) | 168 | WP_156888861.1 | hypothetical protein | - |
| K6973_RS05090 (K6973_05090) | - | 981607..985707 (+) | 4101 | WP_222819663.1 | phage tail tape measure protein | - |
| K6973_RS05095 (K6973_05095) | - | 985720..986490 (+) | 771 | WP_222819664.1 | distal tail protein Dit | - |
| K6973_RS05100 (K6973_05100) | - | 986487..988538 (+) | 2052 | WP_222819665.1 | phage tail spike protein | - |
| K6973_RS11450 (K6973_05105) | - | 988538..989407 (+) | 870 | WP_222819666.1 | collagen-like protein | - |
| K6973_RS05110 (K6973_05110) | - | 989394..989987 (+) | 594 | WP_222819667.1 | hypothetical protein | - |
| K6973_RS05115 (K6973_05115) | - | 989998..991902 (+) | 1905 | WP_222819668.1 | gp58-like family protein | - |
| K6973_RS05120 (K6973_05120) | - | 991911..992342 (+) | 432 | WP_222819669.1 | DUF1617 family protein | - |
| K6973_RS05125 (K6973_05125) | - | 992345..992956 (+) | 612 | WP_050317156.1 | hypothetical protein | - |
| K6973_RS05130 (K6973_05130) | - | 992967..993260 (+) | 294 | WP_222819670.1 | hypothetical protein | - |
| K6973_RS05135 (K6973_05135) | - | 993261..993446 (+) | 186 | WP_222819671.1 | holin | - |
| K6973_RS05140 (K6973_05140) | - | 993558..994775 (+) | 1218 | WP_222819672.1 | peptidoglycan amidohydrolase family protein | - |
| K6973_RS05145 (K6973_05145) | - | 994838..995647 (-) | 810 | WP_222819673.1 | recombinase family protein | - |
| K6973_RS05150 (K6973_05150) | - | 995769..996020 (-) | 252 | WP_222819674.1 | hypothetical protein | - |
| K6973_RS05155 (K6973_05155) | - | 996161..996307 (-) | 147 | WP_164406938.1 | hypothetical protein | - |
| K6973_RS05160 (K6973_05160) | - | 996461..996670 (+) | 210 | WP_011054450.1 | helix-turn-helix transcriptional regulator | - |
| K6973_RS05165 (K6973_05165) | - | 996852..997142 (-) | 291 | WP_222819675.1 | hypothetical protein | - |
| K6973_RS05170 (K6973_05170) | - | 997158..997343 (-) | 186 | WP_046176801.1 | helix-turn-helix transcriptional regulator | - |
| K6973_RS05175 (K6973_05175) | - | 997340..997819 (-) | 480 | WP_222819676.1 | hypothetical protein | - |
| K6973_RS05180 (K6973_05180) | - | 997852..998160 (-) | 309 | WP_165746035.1 | hypothetical protein | - |
| K6973_RS05185 (K6973_05185) | prx | 998335..998517 (+) | 183 | WP_222819677.1 | Paratox | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6975.90 Da Isoelectric Point: 4.0338
>NTDB_id=600108 K6973_RS05185 WP_222819677.1 998335..998517(+) (prx) [Streptococcus dysgalactiae strain DY107]
MLTYDEFKQAIDDGYITADTVMIVRKDGQIFDYALPGEPVRPWEVVTEERVEAVLRELDK
MLTYDEFKQAIDDGYITADTVMIVRKDGQIFDYALPGEPVRPWEVVTEERVEAVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=600108 K6973_RS05185 WP_222819677.1 998335..998517(+) (prx) [Streptococcus dysgalactiae strain DY107]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGCGTTGCCTGGTGAGCCTGTGAGACCGTGGGAGGTTGTGACAGAGGAGAGGGTGGAAGCAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGCGTTGCCTGGTGAGCCTGTGAGACCGTGGGAGGTTGTGACAGAGGAGAGGGTGGAAGCAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
68.333 |
0.483 |