Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   K4756_RS15720 Genome accession   NZ_CP081458
Coordinates   3036677..3036817 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain ps4060     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3031677..3041817
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K4756_RS15695 (K4756_15605) yuxO 3032020..3032400 (-) 381 WP_015483631.1 hotdog fold thioesterase -
  K4756_RS15700 (K4756_15610) comA 3032418..3033062 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  K4756_RS15705 (K4756_15615) comP 3033143..3035443 (-) 2301 WP_046340263.1 histidine kinase Regulator
  K4756_RS15710 (K4756_15620) comX 3035455..3035619 (-) 165 WP_015384519.1 competence pheromone ComX -
  K4756_RS15715 (K4756_15625) - 3035632..3036492 (-) 861 WP_015483633.1 polyprenyl synthetase family protein -
  K4756_RS15720 (K4756_15630) degQ 3036677..3036817 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  K4756_RS15725 - 3037039..3037101 (+) 63 Protein_3039 hypothetical protein -
  K4756_RS15730 (K4756_15635) - 3037279..3037647 (+) 369 WP_015483634.1 hypothetical protein -
  K4756_RS15735 (K4756_15640) pdeH 3037623..3038852 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  K4756_RS15740 (K4756_15645) pncB 3038989..3040461 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  K4756_RS15745 (K4756_15650) pncA 3040477..3041028 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  K4756_RS15750 (K4756_15655) yueI 3041125..3041523 (-) 399 WP_015483635.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=596526 K4756_RS15720 WP_003220708.1 3036677..3036817(-) (degQ) [Bacillus subtilis subsp. subtilis strain ps4060]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=596526 K4756_RS15720 WP_003220708.1 3036677..3036817(-) (degQ) [Bacillus subtilis subsp. subtilis strain ps4060]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1