Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   K4756_RS12140 Genome accession   NZ_CP081458
Coordinates   2373067..2373240 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain ps4060     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2368067..2378240
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K4756_RS12125 (K4756_12055) gcvT 2368866..2369954 (-) 1089 WP_015384081.1 glycine cleavage system aminomethyltransferase GcvT -
  K4756_RS12130 (K4756_12060) hepAA 2370396..2372069 (+) 1674 WP_015384082.1 DEAD/DEAH box helicase -
  K4756_RS12135 (K4756_12065) yqhG 2372090..2372884 (+) 795 WP_003230200.1 YqhG family protein -
  K4756_RS12140 (K4756_12070) sinI 2373067..2373240 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  K4756_RS12145 (K4756_12075) sinR 2373274..2373609 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  K4756_RS12150 (K4756_12080) tasA 2373702..2374487 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  K4756_RS12155 (K4756_12085) sipW 2374551..2375123 (-) 573 WP_080030740.1 signal peptidase I SipW -
  K4756_RS12160 (K4756_12090) tapA 2375107..2375868 (-) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  K4756_RS12165 (K4756_12095) yqzG 2376138..2376464 (+) 327 WP_015384086.1 YqzG/YhdC family protein -
  K4756_RS12170 (K4756_12100) spoIITA 2376506..2376685 (-) 180 WP_003230176.1 YqzE family protein -
  K4756_RS12175 (K4756_12105) comGG 2376757..2377131 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  K4756_RS12180 (K4756_12110) comGF 2377132..2377515 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  K4756_RS12185 (K4756_12115) comGE 2377541..2377888 (-) 348 WP_015384088.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=596504 K4756_RS12140 WP_003230187.1 2373067..2373240(+) (sinI) [Bacillus subtilis subsp. subtilis strain ps4060]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=596504 K4756_RS12140 WP_003230187.1 2373067..2373240(+) (sinI) [Bacillus subtilis subsp. subtilis strain ps4060]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1