Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   KTJ85_RS11665 Genome accession   NZ_CP080509
Coordinates   2315160..2315426 (-) Length   88 a.a.
NCBI ID   WP_238156997.1    Uniprot ID   -
Organism   Bacillus sp. 7D3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2310160..2320426
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KTJ85_RS11615 (KTJ85_11615) sinR 2310323..2310658 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  KTJ85_RS11620 (KTJ85_11620) tasA 2310706..2311491 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  KTJ85_RS11625 (KTJ85_11625) sipW 2311556..2312140 (-) 585 WP_212098460.1 signal peptidase I SipW -
  KTJ85_RS11630 (KTJ85_11630) tapA 2312112..2312783 (-) 672 WP_212098462.1 amyloid fiber anchoring/assembly protein TapA -
  KTJ85_RS11635 (KTJ85_11635) - 2313041..2313370 (+) 330 WP_045510605.1 DUF3889 domain-containing protein -
  KTJ85_RS11640 (KTJ85_11640) - 2313411..2313590 (-) 180 WP_016938971.1 YqzE family protein -
  KTJ85_RS11645 (KTJ85_11645) comGG 2313647..2314024 (-) 378 WP_212098464.1 competence type IV pilus minor pilin ComGG Machinery gene
  KTJ85_RS11650 (KTJ85_11650) comGF 2314026..2314526 (-) 501 WP_249199234.1 competence type IV pilus minor pilin ComGF -
  KTJ85_RS11655 (KTJ85_11655) comGE 2314435..2314749 (-) 315 WP_065981881.1 competence type IV pilus minor pilin ComGE Machinery gene
  KTJ85_RS11660 (KTJ85_11660) comGD 2314733..2315170 (-) 438 WP_045510590.1 competence type IV pilus minor pilin ComGD Machinery gene
  KTJ85_RS11665 (KTJ85_11665) comGC 2315160..2315426 (-) 267 WP_238156997.1 competence type IV pilus major pilin ComGC Machinery gene
  KTJ85_RS11670 (KTJ85_11670) comGB 2315473..2316510 (-) 1038 WP_212098466.1 competence type IV pilus assembly protein ComGB Machinery gene
  KTJ85_RS11675 (KTJ85_11675) comGA 2316497..2317567 (-) 1071 WP_115997636.1 competence type IV pilus ATPase ComGA Machinery gene
  KTJ85_RS11680 (KTJ85_11680) - 2317760..2318710 (-) 951 WP_212098468.1 magnesium transporter CorA family protein -
  KTJ85_RS11685 (KTJ85_11685) - 2318857..2320158 (+) 1302 WP_212098471.1 hemolysin family protein -

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9776.44 Da        Isoelectric Point: 6.7061

>NTDB_id=593401 KTJ85_RS11665 WP_238156997.1 2315160..2315426(-) (comGC) [Bacillus sp. 7D3]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPEMNDLQSEGYIKKNTACPNGKQILIK
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=593401 KTJ85_RS11665 WP_238156997.1 2315160..2315426(-) (comGC) [Bacillus sp. 7D3]
ATGCTGATCGTTTTATTTATTGTTTCCATTCTGCTTTTAATCACGATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGAAAAATGC
CGGAGATGAACGACTTACAATCAGAGGGATATATCAAAAAGAATACAGCCTGCCCGAATGGAAAACAGATTTTAATAAAG
GGCGGGGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602