Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   K0V03_RS01975 Genome accession   NZ_CP080508
Coordinates   337837..338247 (-) Length   136 a.a.
NCBI ID   WP_085186522.1    Uniprot ID   -
Organism   Bacillus subtilis strain HD15     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 333203..384149 337837..338247 within 0


Gene organization within MGE regions


Location: 333203..384149
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K0V03_RS01950 (K0V03_01950) yqeF 333370..334101 (-) 732 WP_085186514.1 SGNH/GDSL hydrolase family protein -
  K0V03_RS01955 (K0V03_01955) cwlH 334353..335105 (-) 753 WP_085186516.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  K0V03_RS01960 (K0V03_01960) yqeD 335292..335918 (+) 627 WP_085186518.1 TVP38/TMEM64 family protein -
  K0V03_RS01965 (K0V03_01965) gnd 335938..336831 (-) 894 WP_041850033.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  K0V03_RS01970 (K0V03_01970) yqeB 337083..337805 (+) 723 WP_085186520.1 hypothetical protein -
  K0V03_RS01975 (K0V03_01975) nucA/comI 337837..338247 (-) 411 WP_085186522.1 sporulation-specific Dnase NucB Machinery gene
  K0V03_RS01980 (K0V03_01980) - 338443..338793 (+) 351 Protein_393 sigma-70 family RNA polymerase sigma factor -
  K0V03_RS01985 (K0V03_01985) spoIVCA 338821..340281 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  K0V03_RS22140 - 340239..340417 (-) 179 Protein_395 hypothetical protein -
  K0V03_RS01990 (K0V03_01990) arsC 340772..341191 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  K0V03_RS01995 (K0V03_01995) acr3 341203..342243 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  K0V03_RS02000 (K0V03_02000) arsK 342266..342706 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  K0V03_RS02005 (K0V03_02005) arsR 342767..343084 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  K0V03_RS02010 (K0V03_02010) yqcI 343456..344220 (-) 765 WP_085186524.1 YqcI/YcgG family protein -
  K0V03_RS02015 (K0V03_02015) rapE 344663..345790 (+) 1128 Protein_401 response regulator aspartate phosphatase RapE -
  K0V03_RS02020 (K0V03_02020) phrE 345780..345914 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  K0V03_RS02025 (K0V03_02025) - 346024..346182 (+) 159 WP_003245945.1 hypothetical protein -
  K0V03_RS02030 (K0V03_02030) yqcG 346541..348136 (+) 1596 WP_085186526.1 LXG family T7SS effector endonuclease toxin YqcG -
  K0V03_RS02035 (K0V03_02035) yqcF 348151..348729 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  K0V03_RS02040 (K0V03_02040) - 348847..348993 (+) 147 WP_009967791.1 hypothetical protein -
  K0V03_RS02045 (K0V03_02045) - 348990..349352 (-) 363 WP_003229947.1 hypothetical protein -
  K0V03_RS02050 (K0V03_02050) - 349368..349847 (-) 480 WP_004399085.1 hypothetical protein -
  K0V03_RS02055 (K0V03_02055) cwlA 350012..350830 (-) 819 WP_085186528.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  K0V03_RS02060 (K0V03_02060) skhD 350875..351297 (-) 423 WP_003246208.1 holin family protein -
  K0V03_RS02065 (K0V03_02065) xepAK 351342..352235 (-) 894 WP_085186530.1 phage portal protein -
  K0V03_RS02070 (K0V03_02070) - 352323..352487 (-) 165 WP_040082457.1 XkdX family protein -
  K0V03_RS02075 (K0V03_02075) yqcD 352484..352819 (-) 336 WP_040082456.1 XkdW family protein -
  K0V03_RS02080 (K0V03_02080) - 352829..353923 (-) 1095 WP_085186532.1 hypothetical protein -
  K0V03_RS02085 (K0V03_02085) - 353927..354199 (-) 273 WP_085186534.1 hypothetical protein -
  K0V03_RS02090 (K0V03_02090) yqcA 354196..354774 (-) 579 WP_085186536.1 YmfQ family protein -
  K0V03_RS02095 (K0V03_02095) yqbT 354758..355804 (-) 1047 WP_085186537.1 baseplate J/gp47 family protein -
  K0V03_RS02100 (K0V03_02100) yqbS 355797..356222 (-) 426 WP_085186539.1 DUF2634 domain-containing protein -
  K0V03_RS02105 (K0V03_02105) - 356235..356501 (-) 267 WP_041850059.1 DUF2577 family protein -
  K0V03_RS02110 (K0V03_02110) yqbQ 356498..357478 (-) 981 WP_085186541.1 phage portal protein -
  K0V03_RS02115 (K0V03_02115) yqbP 357491..358150 (-) 660 WP_085186543.1 LysM peptidoglycan-binding domain-containing protein -
  K0V03_RS02120 (K0V03_02120) yqbO 358143..362900 (-) 4758 WP_085186545.1 phage tail tape measure protein -
  K0V03_RS02125 (K0V03_02125) - 362903..363040 (-) 138 WP_042976732.1 hypothetical protein -
  K0V03_RS02130 (K0V03_02130) - 363082..363531 (-) 450 WP_017697468.1 phage tail assembly chaperone -
  K0V03_RS22440 - 363715..363774 (+) 60 WP_250620102.1 putative holin-like toxin -
  K0V03_RS02140 (K0V03_02140) yqbM 364097..364540 (-) 444 WP_003229930.1 phage tail tube protein -
  K0V03_RS02145 (K0V03_02145) yqbK 364543..365943 (-) 1401 WP_015714313.1 phage tail sheath family protein -
  K0V03_RS02150 (K0V03_02150) - 365944..366135 (-) 192 WP_032679171.1 hypothetical protein -
  K0V03_RS02155 (K0V03_02155) yqbJ 366132..366569 (-) 438 WP_015714315.1 DUF6838 family protein -
  K0V03_RS02160 (K0V03_02160) yqbI 366582..367085 (-) 504 WP_085186547.1 HK97 gp10 family phage protein -
  K0V03_RS02165 (K0V03_02165) yqbH 367082..367444 (-) 363 WP_085186548.1 YqbH/XkdH family protein -
  K0V03_RS02170 (K0V03_02170) gkpG 367441..367836 (-) 396 WP_015714318.1 DUF3199 family protein -
  K0V03_RS02175 (K0V03_02175) yqbF 367841..368152 (-) 312 WP_015714319.1 YqbF domain-containing protein -
  K0V03_RS02180 (K0V03_02180) skdG 368163..369098 (-) 936 WP_085186550.1 phage major capsid protein -
  K0V03_RS02185 (K0V03_02185) yqbD 369117..370091 (-) 975 WP_015714321.1 XkdF-like putative serine protease domain-containing protein -
  K0V03_RS02190 (K0V03_02190) - 370097..370438 (-) 342 WP_220158520.1 hypothetical protein -
  K0V03_RS02195 (K0V03_02195) - 370483..370929 (-) 447 WP_220158521.1 hypothetical protein -
  K0V03_RS02200 (K0V03_02200) yqbB 370974..371891 (-) 918 WP_085186552.1 phage head morphogenesis protein -
  K0V03_RS02205 (K0V03_02205) yqbA 371888..373420 (-) 1533 WP_085186554.1 phage portal protein -
  K0V03_RS02210 (K0V03_02210) stmB 373424..374719 (-) 1296 WP_085186556.1 PBSX family phage terminase large subunit -
  K0V03_RS02215 (K0V03_02215) terS 374712..375431 (-) 720 WP_032722175.1 phage terminase small subunit -
  K0V03_RS02220 (K0V03_02220) - 375955..376143 (-) 189 WP_032722176.1 hypothetical protein -
  K0V03_RS02225 (K0V03_02225) yqaQ 376288..376743 (-) 456 WP_032722177.1 hypothetical protein -
  K0V03_RS02230 (K0V03_02230) - 376834..377487 (-) 654 WP_032722179.1 hypothetical protein -
  K0V03_RS02235 (K0V03_02235) yqaO 377554..377760 (-) 207 WP_032722180.1 XtrA/YqaO family protein -
  K0V03_RS02240 (K0V03_02240) yqaN 377842..378270 (-) 429 WP_032722181.1 RusA family crossover junction endodeoxyribonuclease -
  K0V03_RS02245 (K0V03_02245) - 378366..378515 (-) 150 WP_074794430.1 hypothetical protein -
  K0V03_RS02250 (K0V03_02250) sknM 378506..379447 (-) 942 WP_074794427.1 ATP-binding protein -
  K0V03_RS02255 (K0V03_02255) yqaL 379329..380006 (-) 678 WP_116758330.1 DnaD domain protein -
  K0V03_RS02260 (K0V03_02260) recT 380083..380937 (-) 855 WP_015714338.1 recombinase RecT -
  K0V03_RS02265 (K0V03_02265) yqaJ 380940..381896 (-) 957 WP_015714339.1 YqaJ viral recombinase family protein -
  K0V03_RS02270 (K0V03_02270) - 382000..382194 (-) 195 WP_003229905.1 YqaI family protein -
  K0V03_RS02275 (K0V03_02275) - 382154..382327 (-) 174 WP_120028409.1 hypothetical protein -
  K0V03_RS02280 (K0V03_02280) sknH 382324..382581 (-) 258 WP_015714340.1 YqaH family protein -
  K0V03_RS02285 (K0V03_02285) yqaG 382578..383147 (-) 570 WP_015714341.1 helix-turn-helix transcriptional regulator -
  K0V03_RS02290 (K0V03_02290) - 383221..383361 (-) 141 WP_003229902.1 hypothetical protein -
  K0V03_RS02295 (K0V03_02295) yqaF 383391..383621 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  K0V03_RS02300 (K0V03_02300) sknR 383799..384149 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14995.00 Da        Isoelectric Point: 5.1853

>NTDB_id=593295 K0V03_RS01975 WP_085186522.1 337837..338247(-) (nucA/comI) [Bacillus subtilis strain HD15]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMNSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=593295 K0V03_RS01975 WP_085186522.1 337837..338247(-) (nucA/comI) [Bacillus subtilis strain HD15]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCAATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAACAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAA

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-131)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529