Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   K0H55_RS14285 Genome accession   NZ_CP080370
Coordinates   2951881..2952510 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain PK5086     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2942709..2980285 2951881..2952510 within 0


Gene organization within MGE regions


Location: 2942709..2980285
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K0H55_RS14235 (K0H55_14235) tusE 2942980..2943309 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  K0H55_RS14240 (K0H55_14240) yccX 2943306..2943584 (-) 279 WP_000048250.1 acylphosphatase -
  K0H55_RS14245 (K0H55_14245) rlmI 2943679..2944869 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  K0H55_RS14250 (K0H55_14250) hspQ 2944927..2945244 (+) 318 WP_001295356.1 heat shock protein HspQ -
  K0H55_RS14255 (K0H55_14255) yccU 2945289..2945702 (-) 414 WP_000665217.1 CoA-binding protein -
  K0H55_RS14260 (K0H55_14260) yccT 2945875..2946537 (+) 663 WP_000847791.1 DUF2057 family protein -
  K0H55_RS14265 (K0H55_14265) mgsA 2946633..2947091 (+) 459 WP_000424181.1 methylglyoxal synthase -
  K0H55_RS14270 (K0H55_14270) helD 2947123..2949177 (-) 2055 WP_000420536.1 DNA helicase IV -
  K0H55_RS14275 (K0H55_14275) yccF 2949300..2949746 (+) 447 WP_001261235.1 YccF domain-containing protein -
  K0H55_RS14280 (K0H55_14280) yccS 2949756..2951918 (+) 2163 WP_000875023.1 YccS family putative transporter -
  K0H55_RS14285 (K0H55_14285) sxy/tfoX 2951881..2952510 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  K0H55_RS14290 (K0H55_14290) sulA 2952729..2953238 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  K0H55_RS14295 (K0H55_14295) ompA 2953595..2954647 (+) 1053 WP_001361736.1 porin OmpA -
  K0H55_RS14300 (K0H55_14300) matP 2954723..2955175 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  K0H55_RS14305 (K0H55_14305) ycbZ 2955361..2957121 (+) 1761 WP_000156526.1 Lon protease family protein -
  K0H55_RS14310 (K0H55_14310) fabA 2957190..2957708 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  K0H55_RS14315 (K0H55_14315) rmf 2957778..2957945 (-) 168 WP_000828648.1 ribosome modulation factor -
  K0H55_RS14320 (K0H55_14320) pqiC 2958201..2958764 (-) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  K0H55_RS14325 (K0H55_14325) pqiB 2958761..2960401 (-) 1641 WP_000445535.1 intermembrane transport protein PqiB -
  K0H55_RS14330 (K0H55_14330) pqiA 2960406..2961659 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  K0H55_RS14335 (K0H55_14335) uup 2961789..2963696 (-) 1908 WP_000053069.1 ABC transporter ATP-binding protein -
  K0H55_RS14340 (K0H55_14340) rlmKL 2963708..2965816 (-) 2109 WP_001086520.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  K0H55_RS14345 (K0H55_14345) ycbX 2966060..2967169 (+) 1110 WP_000224270.1 6-N-hydroxylaminopurine resistance protein YcbX -
  K0H55_RS14350 (K0H55_14350) zapC 2967166..2967708 (-) 543 WP_001372781.1 cell division protein ZapC -
  K0H55_RS14355 (K0H55_14355) pyrD 2967882..2968892 (-) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  K0H55_RS14360 (K0H55_14360) ycbF 2969003..2969740 (-) 738 WP_001111449.1 fimbrial chaperone -
  K0H55_RS14365 (K0H55_14365) ycbV 2969706..2970221 (-) 516 WP_000919480.1 fimbrial protein -
  K0H55_RS14370 (K0H55_14370) ycbU 2970229..2970771 (-) 543 WP_000730614.1 fimbrial protein -
  K0H55_RS14375 (K0H55_14375) elfG 2970783..2971853 (-) 1071 WP_060621153.1 fimbrial protein -
  K0H55_RS14380 (K0H55_14380) elfC 2971844..2974444 (-) 2601 WP_000286313.1 fimbrial biogenesis usher protein -
  K0H55_RS14385 (K0H55_14385) - 2974469..2975053 (-) 585 Protein_2830 molecular chaperone -
  K0H55_RS14390 (K0H55_14390) - 2975120..2976282 (+) 1163 WP_085947771.1 IS3-like element IS3 family transposase -
  K0H55_RS14395 (K0H55_14395) - 2976312..2976431 (-) 120 Protein_2832 fimbrial protein -
  K0H55_RS14400 (K0H55_14400) - 2976514..2977056 (-) 543 WP_000750284.1 fimbrial protein -
  K0H55_RS14405 (K0H55_14405) ssuE 2977412..2977987 (+) 576 WP_001263933.1 NADPH-dependent FMN reductase -
  K0H55_RS14410 (K0H55_14410) ssuA 2977980..2978939 (+) 960 WP_001244343.1 aliphatic sulfonate ABC transporter substrate-binding protein SsuA -
  K0H55_RS14415 (K0H55_14415) ssuD 2978936..2980081 (+) 1146 WP_000055996.1 FMNH2-dependent alkanesulfonate monooxygenase -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=592363 K0H55_RS14285 WP_000839153.1 2951881..2952510(-) (sxy/tfoX) [Escherichia coli strain PK5086]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=592363 K0H55_RS14285 WP_000839153.1 2951881..2952510(-) (sxy/tfoX) [Escherichia coli strain PK5086]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1