Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | BALI_RS16845 | Genome accession | NC_021362 |
| Coordinates | 3401722..3401862 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | P69890 |
| Organism | Bacillus paralicheniformis ATCC 9945a | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3396722..3406862
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BALI_RS16820 (BaLi_c34240) | - | 3397015..3397404 (-) | 390 | WP_009329508.1 | hotdog fold thioesterase | - |
| BALI_RS16825 (BaLi_c34250) | comA | 3397421..3398059 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| BALI_RS16830 (BaLi_c34260) | comP | 3398146..3400461 (-) | 2316 | WP_020452789.1 | sensor histidine kinase | Regulator |
| BALI_RS16835 (BaLi_c34270) | comX | 3400482..3400652 (-) | 171 | WP_020452790.1 | competence pheromone ComX | - |
| BALI_RS16840 (BaLi_c34280) | - | 3400624..3401535 (-) | 912 | WP_020452791.1 | polyprenyl synthetase family protein | - |
| BALI_RS16845 (BaLi_c34290) | degQ | 3401722..3401862 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| BALI_RS16850 (BaLi_c34300) | - | 3402348..3402695 (+) | 348 | WP_223254849.1 | hypothetical protein | - |
| BALI_RS16855 (BaLi_c34310) | - | 3402738..3403958 (-) | 1221 | WP_020452793.1 | EAL and HDOD domain-containing protein | - |
| BALI_RS16860 (BaLi_c34320) | - | 3404136..3405605 (-) | 1470 | WP_020452794.1 | nicotinate phosphoribosyltransferase | - |
| BALI_RS16865 (BaLi_c34330) | - | 3405623..3406174 (-) | 552 | WP_020452795.1 | cysteine hydrolase family protein | - |
| BALI_RS16870 (BaLi_c34340) | - | 3406360..3406761 (-) | 402 | WP_039072963.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=59023 BALI_RS16845 WP_003184860.1 3401722..3401862(-) (degQ) [Bacillus paralicheniformis ATCC 9945a]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=59023 BALI_RS16845 WP_003184860.1 3401722..3401862(-) (degQ) [Bacillus paralicheniformis ATCC 9945a]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |