Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BALI_RS16845 Genome accession   NC_021362
Coordinates   3401722..3401862 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis ATCC 9945a     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3396722..3406862
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BALI_RS16820 (BaLi_c34240) - 3397015..3397404 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  BALI_RS16825 (BaLi_c34250) comA 3397421..3398059 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  BALI_RS16830 (BaLi_c34260) comP 3398146..3400461 (-) 2316 WP_020452789.1 sensor histidine kinase Regulator
  BALI_RS16835 (BaLi_c34270) comX 3400482..3400652 (-) 171 WP_020452790.1 competence pheromone ComX -
  BALI_RS16840 (BaLi_c34280) - 3400624..3401535 (-) 912 WP_020452791.1 polyprenyl synthetase family protein -
  BALI_RS16845 (BaLi_c34290) degQ 3401722..3401862 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  BALI_RS16850 (BaLi_c34300) - 3402348..3402695 (+) 348 WP_223254849.1 hypothetical protein -
  BALI_RS16855 (BaLi_c34310) - 3402738..3403958 (-) 1221 WP_020452793.1 EAL and HDOD domain-containing protein -
  BALI_RS16860 (BaLi_c34320) - 3404136..3405605 (-) 1470 WP_020452794.1 nicotinate phosphoribosyltransferase -
  BALI_RS16865 (BaLi_c34330) - 3405623..3406174 (-) 552 WP_020452795.1 cysteine hydrolase family protein -
  BALI_RS16870 (BaLi_c34340) - 3406360..3406761 (-) 402 WP_039072963.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=59023 BALI_RS16845 WP_003184860.1 3401722..3401862(-) (degQ) [Bacillus paralicheniformis ATCC 9945a]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=59023 BALI_RS16845 WP_003184860.1 3401722..3401862(-) (degQ) [Bacillus paralicheniformis ATCC 9945a]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652


Multiple sequence alignment