Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KXY09_RS15615 Genome accession   NZ_CP079719
Coordinates   3167998..3168138 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain LABIM44     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3162998..3173138
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KXY09_RS15590 (KXY09_15580) - 3163325..3163708 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  KXY09_RS15595 (KXY09_15585) comA 3163730..3164374 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  KXY09_RS15600 (KXY09_15590) comP 3164455..3166761 (-) 2307 WP_094032817.1 sensor histidine kinase Regulator
  KXY09_RS15605 (KXY09_15595) comX 3166780..3166956 (-) 177 WP_015240484.1 competence pheromone ComX -
  KXY09_RS15610 (KXY09_15600) - 3166971..3167846 (-) 876 WP_025285191.1 polyprenyl synthetase family protein -
  KXY09_RS15615 (KXY09_15605) degQ 3167998..3168138 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  KXY09_RS15620 (KXY09_15610) - 3168604..3168945 (+) 342 WP_136396570.1 hypothetical protein -
  KXY09_RS15625 (KXY09_15615) - 3168952..3170175 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  KXY09_RS15630 (KXY09_15620) - 3170305..3171771 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  KXY09_RS15635 (KXY09_15625) - 3171789..3172340 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  KXY09_RS15640 (KXY09_15630) - 3172437..3172835 (-) 399 WP_015240486.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=588930 KXY09_RS15615 WP_003152043.1 3167998..3168138(-) (degQ) [Bacillus velezensis strain LABIM44]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=588930 KXY09_RS15615 WP_003152043.1 3167998..3168138(-) (degQ) [Bacillus velezensis strain LABIM44]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891