Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   KV103_RS11595 Genome accession   NZ_CP078149
Coordinates   2439240..2439617 (-) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain BS-G1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2434240..2444617
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KV103_RS11555 - 2434737..2435531 (+) 795 WP_007612541.1 YqhG family protein -
  KV103_RS11560 sinI 2435708..2435881 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  KV103_RS11565 sinR 2435915..2436250 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KV103_RS11570 tasA 2436298..2437083 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  KV103_RS11575 sipW 2437148..2437732 (-) 585 WP_032874025.1 signal peptidase I SipW -
  KV103_RS11580 tapA 2437704..2438375 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  KV103_RS11585 - 2438634..2438963 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  KV103_RS11590 - 2439004..2439183 (-) 180 WP_022552966.1 YqzE family protein -
  KV103_RS11595 comGG 2439240..2439617 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  KV103_RS11600 comGF 2439618..2440118 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  KV103_RS11605 comGE 2440027..2440341 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  KV103_RS11610 comGD 2440325..2440762 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  KV103_RS11615 comGC 2440752..2441060 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  KV103_RS11620 comGB 2441065..2442102 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  KV103_RS11625 comGA 2442089..2443159 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  KV103_RS11630 - 2443356..2444306 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=587361 KV103_RS11595 WP_032874019.1 2439240..2439617(-) (comGG) [Bacillus velezensis strain BS-G1]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=587361 KV103_RS11595 WP_032874019.1 2439240..2439617(-) (comGG) [Bacillus velezensis strain BS-G1]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488