Detailed information
Bioinformatically predicted
Overview
| Name | pilK | Type | Machinery gene |
| Locus tag | KWY94_RS05355 | Genome accession | NZ_CP078113 |
| Coordinates | 1024810..1025421 (+) | Length | 203 a.a. |
| NCBI ID | WP_218461146.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain O2D156 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1025966..1064552 | 1024810..1025421 | flank | 545 |
Gene organization within MGE regions
Location: 1024810..1064552
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KWY94_RS05355 (KWY94_05355) | pilK | 1024810..1025421 (+) | 612 | WP_218461146.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| KWY94_RS05360 (KWY94_05360) | pilL | 1025423..1025896 (+) | 474 | WP_218461157.1 | PilX family type IV pilin | Machinery gene |
| KWY94_RS05365 (KWY94_05365) | - | 1025966..1026274 (-) | 309 | WP_025456241.1 | AzlD family protein | - |
| KWY94_RS05370 (KWY94_05370) | - | 1026271..1026981 (-) | 711 | Protein_1031 | AzlC family ABC transporter permease | - |
| KWY94_RS05375 (KWY94_05375) | dut | 1027147..1027599 (+) | 453 | WP_003687923.1 | dUTP diphosphatase | - |
| KWY94_RS05380 (KWY94_05380) | dapC | 1027671..1028858 (+) | 1188 | WP_218461147.1 | succinyldiaminopimelate transaminase | - |
| KWY94_RS05385 (KWY94_05385) | yaaA | 1029014..1029793 (+) | 780 | WP_003692836.1 | peroxide stress protein YaaA | - |
| KWY94_RS05400 (KWY94_05400) | - | 1030323..1031516 (+) | 1194 | WP_017146746.1 | integrase arm-type DNA-binding domain-containing protein | - |
| KWY94_RS05405 (KWY94_05405) | - | 1031872..1032141 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| KWY94_RS05410 (KWY94_05410) | - | 1032336..1033019 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| KWY94_RS11920 | - | 1033333..1033566 (-) | 234 | Protein_1038 | hypothetical protein | - |
| KWY94_RS05420 (KWY94_05420) | - | 1033677..1033892 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| KWY94_RS05425 (KWY94_05425) | - | 1033944..1034435 (-) | 492 | WP_003696912.1 | siphovirus Gp157 family protein | - |
| KWY94_RS05430 (KWY94_05430) | - | 1034432..1034614 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| KWY94_RS05435 (KWY94_05435) | - | 1034754..1035440 (-) | 687 | WP_218461093.1 | phage replication initiation protein, NGO0469 family | - |
| KWY94_RS05440 (KWY94_05440) | - | 1035509..1035670 (-) | 162 | WP_004464809.1 | hypothetical protein | - |
| KWY94_RS05445 (KWY94_05445) | - | 1035667..1035942 (-) | 276 | WP_010359972.1 | NGO1622 family putative holin | - |
| KWY94_RS05450 (KWY94_05450) | - | 1036095..1036427 (-) | 333 | WP_050154664.1 | hypothetical protein | - |
| KWY94_RS05455 (KWY94_05455) | - | 1036569..1036844 (-) | 276 | WP_047925817.1 | hypothetical protein | - |
| KWY94_RS05460 (KWY94_05460) | - | 1036841..1037317 (-) | 477 | WP_002255718.1 | hypothetical protein | - |
| KWY94_RS05465 (KWY94_05465) | - | 1037350..1037550 (-) | 201 | WP_047954343.1 | hypothetical protein | - |
| KWY94_RS05470 (KWY94_05470) | - | 1037749..1038162 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| KWY94_RS05475 (KWY94_05475) | - | 1038159..1038620 (-) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| KWY94_RS05480 (KWY94_05480) | - | 1038637..1039074 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| KWY94_RS05485 (KWY94_05485) | - | 1039189..1039905 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| KWY94_RS05490 (KWY94_05490) | - | 1039974..1040210 (+) | 237 | WP_003687971.1 | Cro/CI family transcriptional regulator | - |
| KWY94_RS05495 (KWY94_05495) | - | 1040290..1040445 (+) | 156 | WP_003703527.1 | hypothetical protein | - |
| KWY94_RS05500 (KWY94_05500) | - | 1040422..1040610 (-) | 189 | WP_003698903.1 | hypothetical protein | - |
| KWY94_RS05505 (KWY94_05505) | - | 1040783..1041010 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| KWY94_RS05510 (KWY94_05510) | - | 1041128..1042192 (+) | 1065 | WP_003689134.1 | hypothetical protein | - |
| KWY94_RS05515 (KWY94_05515) | - | 1042189..1043550 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| KWY94_RS05520 (KWY94_05520) | - | 1043567..1043797 (+) | 231 | WP_050154378.1 | hypothetical protein | - |
| KWY94_RS05525 (KWY94_05525) | - | 1043888..1044382 (+) | 495 | WP_115067539.1 | DUF3310 domain-containing protein | - |
| KWY94_RS05530 (KWY94_05530) | - | 1044559..1044708 (+) | 150 | WP_218461078.1 | hypothetical protein | - |
| KWY94_RS11460 | - | 1044737..1045018 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| KWY94_RS05535 (KWY94_05535) | - | 1045009..1045446 (+) | 438 | WP_071242831.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KWY94_RS05540 (KWY94_05540) | - | 1045439..1045744 (+) | 306 | WP_003687981.1 | nuclease domain-containing protein | - |
| KWY94_RS05545 (KWY94_05545) | - | 1045741..1046124 (+) | 384 | WP_003690918.1 | recombination protein NinB | - |
| KWY94_RS05550 (KWY94_05550) | - | 1046115..1046633 (+) | 519 | WP_003687984.1 | HNH endonuclease | - |
| KWY94_RS05555 (KWY94_05555) | - | 1046698..1047120 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| KWY94_RS11465 | - | 1047120..1047659 (+) | 540 | WP_003690920.1 | hypothetical protein | - |
| KWY94_RS05570 (KWY94_05570) | - | 1047640..1048914 (+) | 1275 | WP_003701186.1 | PBSX family phage terminase large subunit | - |
| KWY94_RS05575 (KWY94_05575) | - | 1048899..1050479 (+) | 1581 | WP_256345078.1 | hypothetical protein | - |
| KWY94_RS05580 (KWY94_05580) | - | 1051404..1052600 (+) | 1197 | WP_215322114.1 | hypothetical protein | - |
| KWY94_RS05585 (KWY94_05585) | - | 1052597..1059901 (+) | 7305 | WP_256345079.1 | PLxRFG domain-containing protein | - |
| KWY94_RS05590 (KWY94_05590) | - | 1060527..1061822 (+) | 1296 | WP_003690933.1 | DUF4043 family protein | - |
| KWY94_RS05595 (KWY94_05595) | - | 1061877..1062350 (+) | 474 | WP_003690936.1 | hypothetical protein | - |
| KWY94_RS05600 (KWY94_05600) | - | 1062356..1062841 (+) | 486 | WP_003687997.1 | hypothetical protein | - |
| KWY94_RS05605 (KWY94_05605) | - | 1062838..1063512 (+) | 675 | WP_003687998.1 | hypothetical protein | - |
| KWY94_RS05610 (KWY94_05610) | - | 1063515..1063664 (+) | 150 | WP_003706419.1 | hypothetical protein | - |
| KWY94_RS05615 (KWY94_05615) | - | 1063701..1064552 (-) | 852 | WP_197098219.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 203 a.a. Molecular weight: 22011.88 Da Isoelectric Point: 8.0862
>NTDB_id=586844 KWY94_RS05355 WP_218461146.1 1024810..1025421(+) (pilK) [Neisseria gonorrhoeae strain O2D156]
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYAA
DSKVTFSENCEKGLCTAVNVRTNDNGNEEAFGNIVVQGKPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYKKGTGNVSKMS
RYIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYAA
DSKVTFSENCEKGLCTAVNVRTNDNGNEEAFGNIVVQGKPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYKKGTGNVSKMS
RYIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ
Nucleotide
Download Length: 612 bp
>NTDB_id=586844 KWY94_RS05355 WP_218461146.1 1024810..1025421(+) (pilK) [Neisseria gonorrhoeae strain O2D156]
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGCGGGAGGGCGAATTTCAGGTTTTGGATTTGGAATATGCTGCG
GACAGTAAGGTTACGTTTAGCGAAAACTGTGAAAAAGGTCTGTGTACCGCAGTGAATGTGCGGACAAATGATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGCAAGGCAAGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTG
GCAAAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGTACGGGAAACGTCAGCAAAATGTCG
CGCTATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGCGGGAGGGCGAATTTCAGGTTTTGGATTTGGAATATGCTGCG
GACAGTAAGGTTACGTTTAGCGAAAACTGTGAAAAAGGTCTGTGTACCGCAGTGAATGTGCGGACAAATGATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGCAAGGCAAGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTG
GCAAAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGTACGGGAAACGTCAGCAAAATGTCG
CGCTATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilK | Neisseria gonorrhoeae MS11 |
95.567 |
100 |
0.956 |