Detailed information    

insolico Bioinformatically predicted

Overview

Name   HI0659   Type   Machinery gene
Locus tag   I872_RS02955 Genome accession   NC_021175
Coordinates   611513..611806 (+) Length   97 a.a.
NCBI ID   WP_015604674.1    Uniprot ID   A0A512AAX1
Organism   Streptococcus cristatus AS 1.3089     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 602331..616597 611513..611806 within 0


Gene organization within MGE regions


Location: 602331..616597
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I872_RS02895 (I872_02880) - 602331..603494 (-) 1164 WP_015604661.1 tyrosine-type recombinase/integrase -
  I872_RS10795 (I872_02885) - 603589..604263 (-) 675 WP_015604662.1 helix-turn-helix domain-containing protein -
  I872_RS02905 (I872_02890) - 604434..604622 (+) 189 WP_015604663.1 hypothetical protein -
  I872_RS02910 (I872_02895) - 604857..605123 (+) 267 WP_015604664.1 hypothetical protein -
  I872_RS02915 (I872_02900) - 605197..605628 (+) 432 WP_015604665.1 hypothetical protein -
  I872_RS12175 - 605625..605804 (+) 180 Protein_553 hypothetical protein -
  I872_RS11995 - 605906..606046 (+) 141 WP_167320506.1 hypothetical protein -
  I872_RS02920 (I872_02905) - 606134..606856 (+) 723 WP_231914051.1 DnaD domain protein -
  I872_RS02925 (I872_02910) - 606872..607696 (+) 825 WP_015604667.1 ATP-binding protein -
  I872_RS02930 (I872_02915) - 608002..608448 (+) 447 WP_015604668.1 hypothetical protein -
  I872_RS12000 (I872_02920) - 608763..608939 (+) 177 WP_015604669.1 hypothetical protein -
  I872_RS02935 (I872_02925) - 609018..609650 (+) 633 WP_015604670.1 hypothetical protein -
  I872_RS02940 (I872_02930) - 609659..610141 (+) 483 WP_015604671.1 hypothetical protein -
  I872_RS02945 (I872_02935) - 610122..610532 (+) 411 WP_015604672.1 hypothetical protein -
  I872_RS02950 (I872_02940) - 611158..611523 (+) 366 WP_015604673.1 type II toxin-antitoxin system RelE/ParE family toxin -
  I872_RS02955 (I872_02945) HI0659 611513..611806 (+) 294 WP_015604674.1 helix-turn-helix domain-containing protein Machinery gene
  I872_RS02960 (I872_02950) - 612074..612649 (+) 576 WP_015604675.1 hypothetical protein -
  I872_RS02965 (I872_02955) - 612867..613052 (-) 186 WP_015604676.1 hypothetical protein -
  I872_RS02970 (I872_02960) - 613126..614136 (-) 1011 WP_015604677.1 lactonase family protein -
  I872_RS02975 (I872_02965) - 614376..614642 (+) 267 WP_015604678.1 hypothetical protein -
  I872_RS02980 (I872_02970) - 614671..615936 (+) 1266 WP_015604679.1 efflux RND transporter periplasmic adaptor subunit -
  I872_RS02985 (I872_02975) - 615923..616597 (+) 675 WP_015604680.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 97 a.a.        Molecular weight: 10678.33 Da        Isoelectric Point: 5.1991

>NTDB_id=58439 I872_RS02955 WP_015604674.1 611513..611806(+) (HI0659) [Streptococcus cristatus AS 1.3089]
MKNSAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEELSGVSQPVIARMETGKTSPQLDTVLKVL
ASLGKTLAVVPLEHEQA

Nucleotide


Download         Length: 294 bp        

>NTDB_id=58439 I872_RS02955 WP_015604674.1 611513..611806(+) (HI0659) [Streptococcus cristatus AS 1.3089]
ATGAAAAATAGTGCGATCGGCAGCAATTGGAAAGATGTTAGAGCTGAGCTTTTTAGCAAAGAGGAGATTTTAGAAAGTGA
TATGCGCGTGGCTATCATGAGCGAGCTTATCGAGGCCAGAAATGAGAAGGGAATAAGCCAAAAGAAATTGGAGGAATTAA
GTGGTGTAAGTCAGCCTGTCATTGCTAGAATGGAAACAGGTAAGACAAGCCCGCAACTGGACACGGTGCTAAAAGTATTA
GCAAGTCTGGGAAAAACTTTAGCAGTGGTACCTTTAGAACATGAACAGGCATAG

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(37-88)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A512AAX1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  HI0659 Haemophilus influenzae Rd KW20

57.292

98.969

0.567

Multiple sequence alignment