Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   SPN032672_RS08910 Genome accession   NC_021003
Coordinates   1667548..1667697 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae SPN032672     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 1664806..1666681 1667548..1667697 flank 867


Gene organization within MGE regions


Location: 1664806..1667697
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPN032672_RS12985 - 1664806..1665620 (-) 815 Protein_1665 IS5-like element IS1515 family transposase -
  SPN032672_RS12330 - 1665877..1666681 (+) 805 WP_128887636.1 IS5 family transposase -
  SPN032672_RS08900 blpM 1666831..1667085 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  SPN032672_RS08905 blpN 1667101..1667304 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  SPN032672_RS08910 cipB 1667548..1667697 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=57902 SPN032672_RS08910 WP_001818346.1 1667548..1667697(+) (cipB) [Streptococcus pneumoniae SPN032672]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=57902 SPN032672_RS08910 WP_001818346.1 1667548..1667697(+) (cipB) [Streptococcus pneumoniae SPN032672]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment