Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KP952_RS12505 Genome accession   NZ_CP076731
Coordinates   2356188..2356361 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain Miz-8     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2351188..2361361
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KP952_RS12490 (KP952_12490) gcvT 2351988..2353076 (-) 1089 WP_017696204.1 glycine cleavage system aminomethyltransferase GcvT -
  KP952_RS12495 (KP952_12495) hepAA 2353517..2355190 (+) 1674 WP_038829735.1 DEAD/DEAH box helicase -
  KP952_RS12500 (KP952_12500) yqhG 2355211..2356005 (+) 795 WP_014480249.1 YqhG family protein -
  KP952_RS12505 (KP952_12505) sinI 2356188..2356361 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  KP952_RS12510 (KP952_12510) sinR 2356395..2356730 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KP952_RS12515 (KP952_12515) tasA 2356823..2357608 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  KP952_RS12520 (KP952_12520) sipW 2357672..2358244 (-) 573 WP_003230181.1 signal peptidase I SipW -
  KP952_RS12525 (KP952_12525) tapA 2358228..2358989 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  KP952_RS12530 (KP952_12530) yqzG 2359261..2359587 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KP952_RS12535 (KP952_12535) spoIITA 2359629..2359808 (-) 180 WP_014480252.1 YqzE family protein -
  KP952_RS12540 (KP952_12540) comGG 2359879..2360253 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  KP952_RS12545 (KP952_12545) comGF 2360254..2360637 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  KP952_RS12550 (KP952_12550) comGE 2360663..2361010 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=577760 KP952_RS12505 WP_003230187.1 2356188..2356361(+) (sinI) [Bacillus subtilis subsp. subtilis strain Miz-8]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=577760 KP952_RS12505 WP_003230187.1 2356188..2356361(+) (sinI) [Bacillus subtilis subsp. subtilis strain Miz-8]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1