Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | MQC90_RS13350 | Genome accession | NZ_CP094361 |
| Coordinates | 2547662..2547835 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis strain NCIB 3610 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2542662..2552835
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MQC90_RS13335 | gcvT | 2543461..2544549 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| MQC90_RS13340 | yqhH | 2544991..2546664 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| MQC90_RS13345 | yqhG | 2546685..2547479 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| MQC90_RS13350 | sinI | 2547662..2547835 (+) | 174 | WP_003230187.1 | anti-repressor SinI family protein | Regulator |
| MQC90_RS13355 | sinR | 2547869..2548204 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| MQC90_RS13360 | tasA | 2548297..2549082 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| MQC90_RS13365 | sipW | 2549146..2549718 (-) | 573 | WP_003246088.1 | signal peptidase I | - |
| MQC90_RS13370 | tapA | 2549702..2550463 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| MQC90_RS13375 | yqzG | 2550735..2551061 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| MQC90_RS13380 | spoIIT | 2551103..2551282 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| MQC90_RS13385 | comGG | 2551353..2551727 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| MQC90_RS13390 | comGF | 2551728..2552111 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| MQC90_RS13395 | comGE | 2552137..2552484 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=577673 MQC90_RS13350 WP_003230187.1 2547662..2547835(+) (sinI) [Bacillus subtilis strain NCIB 3610]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=577673 MQC90_RS13350 WP_003230187.1 2547662..2547835(+) (sinI) [Bacillus subtilis strain NCIB 3610]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |