Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG49_RS00880 Genome accession   NZ_CP094173
Coordinates   185227..185352 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe0001     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 180227..190352
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG49_RS00855 (MPG49_00855) - 180290..182509 (+) 2220 WP_245052473.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG49_RS00860 (MPG49_00860) panD 182499..182849 (+) 351 WP_000142205.1 aspartate 1-decarboxylase -
  MPG49_RS00865 (MPG49_00865) - 182860..183153 (+) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  MPG49_RS00870 (MPG49_00870) - 183153..184148 (+) 996 WP_245053072.1 PDZ domain-containing protein -
  MPG49_RS00875 (MPG49_00875) comB6 184156..185211 (+) 1056 WP_245053074.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG49_RS00880 (MPG49_00880) comB7 185227..185352 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG49_RS00885 (MPG49_00885) comB8 185349..186092 (+) 744 WP_000660533.1 virB8 family protein Machinery gene
  MPG49_RS00890 (MPG49_00890) comB9 186092..187054 (+) 963 WP_245052475.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG49_RS00895 (MPG49_00895) comB10 187047..188183 (+) 1137 WP_245052477.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG49_RS00900 (MPG49_00900) - 188253..189665 (+) 1413 WP_245052481.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=577012 MPG49_RS00880 WP_001217874.1 185227..185352(+) (comB7) [Helicobacter pylori strain Hpfe0001]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=577012 MPG49_RS00880 WP_001217874.1 185227..185352(+) (comB7) [Helicobacter pylori strain Hpfe0001]
ATGAGAATTTTTTTTGTTATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878