Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG84_RS00700 Genome accession   NZ_CP094164
Coordinates   151479..151604 (+) Length   41 a.a.
NCBI ID   WP_001217867.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe0012     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 146479..156604
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG84_RS00675 (MPG84_00675) - 146539..148761 (+) 2223 WP_245059601.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG84_RS00680 (MPG84_00680) panD 148751..149101 (+) 351 WP_180403071.1 aspartate 1-decarboxylase -
  MPG84_RS00685 (MPG84_00685) - 149112..149405 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG84_RS00690 (MPG84_00690) - 149405..150400 (+) 996 WP_245060136.1 PDZ domain-containing protein -
  MPG84_RS00695 (MPG84_00695) comB6 150408..151463 (+) 1056 WP_245060138.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG84_RS00700 (MPG84_00700) comB7 151479..151604 (+) 126 WP_001217867.1 hypothetical protein Machinery gene
  MPG84_RS00705 (MPG84_00705) comB8 151601..152344 (+) 744 WP_245059603.1 virB8 family protein Machinery gene
  MPG84_RS00710 (MPG84_00710) comB9 152344..153309 (+) 966 WP_245059604.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG84_RS00715 (MPG84_00715) comB10 153302..154438 (+) 1137 WP_245059605.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG84_RS00720 (MPG84_00720) - 154508..155920 (+) 1413 WP_245059606.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4830.88 Da        Isoelectric Point: 9.3278

>NTDB_id=576729 MPG84_RS00700 WP_001217867.1 151479..151604(+) (comB7) [Helicobacter pylori strain Hpfe0012]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=576729 MPG84_RS00700 WP_001217867.1 151479..151604(+) (comB7) [Helicobacter pylori strain Hpfe0012]
ATGAGAATTTTTTTTGTTATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829