Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   LEUCM_RS05785 Genome accession   NZ_AP017929
Coordinates   1155690..1155989 (+) Length   99 a.a.
NCBI ID   WP_025016383.1    Uniprot ID   -
Organism   Latilactobacillus sakei subsp. sakei DSM 20017 = JCM 1157 strain LT-13     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1150690..1160989
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LEUCM_RS05760 (LACBS_01131) - 1151894..1152268 (-) 375 WP_011375004.1 hypothetical protein -
  LEUCM_RS05765 (LACBS_01132) - 1152365..1152865 (+) 501 WP_016265379.1 VanZ family protein -
  LEUCM_RS05770 (LACBS_01133) - 1152956..1153687 (+) 732 WP_011375002.1 YebC/PmpR family DNA-binding transcriptional regulator -
  LEUCM_RS05775 (LACBS_01134) comGA 1153803..1154693 (+) 891 WP_025016380.1 competence type IV pilus ATPase ComGA Machinery gene
  LEUCM_RS05780 (LACBS_01135) comGB 1154686..1155693 (+) 1008 WP_056936423.1 type II secretion system F family protein Machinery gene
  LEUCM_RS05785 (LACBS_01136) comGC 1155690..1155989 (+) 300 WP_025016383.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  LEUCM_RS05790 (LACBS_01137) comGD 1155961..1156413 (+) 453 WP_025016384.1 competence type IV pilus minor pilin ComGD Machinery gene
  LEUCM_RS05795 (LACBS_01138) comGE 1156400..1156705 (+) 306 WP_025016385.1 hypothetical protein Machinery gene
  LEUCM_RS05800 (LACBS_01139) comGF 1156680..1157192 (+) 513 WP_025016386.1 competence type IV pilus minor pilin ComGF Machinery gene
  LEUCM_RS05805 (LACBS_01140) - 1157155..1157505 (+) 351 WP_096695394.1 hypothetical protein -
  LEUCM_RS05810 (LACBS_01141) - 1157607..1158626 (+) 1020 WP_241652828.1 class I SAM-dependent methyltransferase -
  LEUCM_RS05815 (LACBS_01142) - 1158648..1159844 (+) 1197 WP_025016389.1 acetate/propionate family kinase -
  LEUCM_RS05820 (LACBS_01143) - 1159899..1160357 (+) 459 WP_025016390.1 hypothetical protein -

Sequence


Protein


Download         Length: 99 a.a.        Molecular weight: 11067.03 Da        Isoelectric Point: 10.1321

>NTDB_id=57671 LEUCM_RS05785 WP_025016383.1 1155690..1155989(+) (comGC) [Latilactobacillus sakei subsp. sakei DSM 20017 = JCM 1157 strain LT-13]
MKKKRNAFTLIEMVIVLAIVALLILLISPNLVAQKQRAEKKTDQALVTTLQTQVELAADEQGHQIKSLDELTDKYISKDQ
LKHAKEKGITIDSGTVKQK

Nucleotide


Download         Length: 300 bp        

>NTDB_id=57671 LEUCM_RS05785 WP_025016383.1 1155690..1155989(+) (comGC) [Latilactobacillus sakei subsp. sakei DSM 20017 = JCM 1157 strain LT-13]
ATGAAGAAAAAAAGAAATGCTTTTACATTAATCGAAATGGTAATTGTTCTAGCAATTGTGGCGTTGTTAATTTTATTAAT
CTCACCAAATTTGGTGGCTCAAAAACAGCGCGCGGAGAAGAAAACCGATCAAGCTTTAGTGACGACTTTACAAACGCAAG
TTGAATTGGCTGCCGATGAACAAGGTCATCAAATTAAGAGTCTAGATGAATTAACGGATAAGTATATTTCAAAAGACCAA
TTAAAGCACGCAAAGGAGAAGGGGATTACAATTGATAGCGGCACGGTTAAGCAAAAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Latilactobacillus sakei subsp. sakei 23K

89.899

100

0.899


Multiple sequence alignment