Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | KPG64_RS01770 | Genome accession | NZ_CP076539 |
| Coordinates | 313563..313841 (+) | Length | 92 a.a. |
| NCBI ID | WP_042596968.1 | Uniprot ID | A0A9X6Z675 |
| Organism | Bacillus thuringiensis strain GR007 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 304836..348644 | 313563..313841 | within | 0 |
Gene organization within MGE regions
Location: 304836..348644
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KPG64_RS01700 (KPG64_01700) | - | 304836..305960 (-) | 1125 | WP_042596948.1 | tyrosine-type recombinase/integrase | - |
| KPG64_RS01705 (KPG64_01705) | - | 306135..306293 (+) | 159 | WP_000970855.1 | hypothetical protein | - |
| KPG64_RS01710 (KPG64_01710) | - | 306723..307586 (-) | 864 | WP_042596950.1 | hypothetical protein | - |
| KPG64_RS01715 (KPG64_01715) | - | 307766..308119 (-) | 354 | WP_042596951.1 | helix-turn-helix domain-containing protein | - |
| KPG64_RS01720 (KPG64_01720) | - | 308636..309763 (+) | 1128 | WP_080775517.1 | AimR family lysis-lysogeny pheromone receptor | - |
| KPG64_RS01725 (KPG64_01725) | - | 309766..309909 (+) | 144 | WP_003276351.1 | hypothetical protein | - |
| KPG64_RS32025 | - | 310112..310240 (+) | 129 | WP_254905051.1 | hypothetical protein | - |
| KPG64_RS01730 (KPG64_01730) | - | 310252..310605 (-) | 354 | WP_042596955.1 | helix-turn-helix domain-containing protein | - |
| KPG64_RS01735 (KPG64_01735) | - | 310833..311057 (+) | 225 | WP_042596958.1 | helix-turn-helix domain-containing protein | - |
| KPG64_RS01740 (KPG64_01740) | - | 311073..311423 (+) | 351 | WP_042596960.1 | helix-turn-helix domain-containing protein | - |
| KPG64_RS01745 (KPG64_01745) | - | 311420..311569 (+) | 150 | WP_155721722.1 | hypothetical protein | - |
| KPG64_RS01750 (KPG64_01750) | - | 311617..311793 (+) | 177 | WP_042596961.1 | hypothetical protein | - |
| KPG64_RS01755 (KPG64_01755) | - | 311798..312538 (+) | 741 | WP_042596963.1 | DnaD domain protein | - |
| KPG64_RS01760 (KPG64_01760) | - | 312486..313349 (+) | 864 | WP_042596964.1 | ATP-binding protein | - |
| KPG64_RS01765 (KPG64_01765) | - | 313352..313546 (+) | 195 | WP_042596967.1 | hypothetical protein | - |
| KPG64_RS01770 (KPG64_01770) | abrB | 313563..313841 (+) | 279 | WP_042596968.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| KPG64_RS01775 (KPG64_01775) | - | 313834..314193 (+) | 360 | WP_042596970.1 | hypothetical protein | - |
| KPG64_RS01780 (KPG64_01780) | - | 314212..314379 (+) | 168 | WP_042596972.1 | DUF3954 domain-containing protein | - |
| KPG64_RS01785 (KPG64_01785) | - | 314405..314656 (+) | 252 | WP_042596973.1 | hypothetical protein | - |
| KPG64_RS01790 (KPG64_01790) | - | 314676..315131 (+) | 456 | WP_042596975.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| KPG64_RS01795 (KPG64_01795) | - | 315394..315585 (+) | 192 | WP_000283199.1 | hypothetical protein | - |
| KPG64_RS31505 | - | 315608..315787 (+) | 180 | Protein_302 | hypothetical protein | - |
| KPG64_RS01805 (KPG64_01805) | - | 316182..316457 (+) | 276 | WP_042596978.1 | hypothetical protein | - |
| KPG64_RS01810 (KPG64_01810) | - | 316505..316762 (+) | 258 | WP_042596980.1 | hypothetical protein | - |
| KPG64_RS01815 (KPG64_01815) | - | 316793..317098 (+) | 306 | WP_042596982.1 | hypothetical protein | - |
| KPG64_RS01820 (KPG64_01820) | ltrA | 317817..319616 (+) | 1800 | WP_000108305.1 | group II intron reverse transcriptase/maturase | - |
| KPG64_RS01830 (KPG64_01830) | - | 319734..320054 (+) | 321 | WP_042596985.1 | hypothetical protein | - |
| KPG64_RS01835 (KPG64_01835) | - | 320093..320353 (+) | 261 | WP_042596986.1 | hypothetical protein | - |
| KPG64_RS01840 (KPG64_01840) | - | 320549..320773 (+) | 225 | WP_231130549.1 | hypothetical protein | - |
| KPG64_RS01845 (KPG64_01845) | - | 320889..321098 (+) | 210 | WP_042596990.1 | hypothetical protein | - |
| KPG64_RS01850 (KPG64_01850) | - | 321144..321410 (+) | 267 | WP_052497238.1 | hypothetical protein | - |
| KPG64_RS01855 (KPG64_01855) | - | 321522..321692 (+) | 171 | WP_042596992.1 | hypothetical protein | - |
| KPG64_RS01860 (KPG64_01860) | - | 321720..322202 (+) | 483 | WP_000166190.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| KPG64_RS01865 (KPG64_01865) | - | 322202..322744 (+) | 543 | WP_001012113.1 | site-specific integrase | - |
| KPG64_RS01870 (KPG64_01870) | - | 323379..323561 (+) | 183 | WP_042596994.1 | hypothetical protein | - |
| KPG64_RS32190 (KPG64_01875) | - | 323593..324021 (+) | 429 | WP_042596997.1 | hypothetical protein | - |
| KPG64_RS01880 (KPG64_01880) | - | 324021..324245 (+) | 225 | WP_042597000.1 | hypothetical protein | - |
| KPG64_RS32195 | - | 324250..324414 (+) | 165 | Protein_318 | helix-turn-helix domain-containing protein | - |
| KPG64_RS01890 (KPG64_01890) | - | 324530..324865 (+) | 336 | WP_042597003.1 | HNH endonuclease | - |
| KPG64_RS01895 (KPG64_01895) | - | 325016..325372 (+) | 357 | WP_042597004.1 | hypothetical protein | - |
| KPG64_RS01900 (KPG64_01900) | - | 325369..327024 (+) | 1656 | WP_042597006.1 | terminase TerL endonuclease subunit | - |
| KPG64_RS01905 (KPG64_01905) | - | 327029..328174 (+) | 1146 | WP_080775450.1 | phage portal protein | - |
| KPG64_RS01910 (KPG64_01910) | - | 328309..329538 (-) | 1230 | WP_001236353.1 | IS110 family transposase | - |
| KPG64_RS01915 (KPG64_01915) | - | 329912..330700 (+) | 789 | WP_062804247.1 | head maturation protease, ClpP-related | - |
| KPG64_RS01920 (KPG64_01920) | - | 330704..331858 (+) | 1155 | WP_000234879.1 | phage major capsid protein | - |
| KPG64_RS01925 (KPG64_01925) | - | 331864..332157 (+) | 294 | WP_000536353.1 | hypothetical protein | - |
| KPG64_RS01930 (KPG64_01930) | - | 332159..332533 (+) | 375 | WP_001182260.1 | phage head closure protein | - |
| KPG64_RS01935 (KPG64_01935) | - | 332521..332958 (+) | 438 | WP_062804248.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| KPG64_RS01940 (KPG64_01940) | - | 332955..333317 (+) | 363 | WP_062804249.1 | DUF3168 domain-containing protein | - |
| KPG64_RS01945 (KPG64_01945) | - | 333333..333917 (+) | 585 | WP_062804250.1 | major tail protein | - |
| KPG64_RS01950 (KPG64_01950) | - | 333974..334348 (+) | 375 | WP_042989393.1 | hypothetical protein | - |
| KPG64_RS01955 (KPG64_01955) | - | 334513..339510 (+) | 4998 | WP_062804251.1 | phage tail tape measure protein | - |
| KPG64_RS01960 (KPG64_01960) | - | 339550..341019 (+) | 1470 | WP_042597010.1 | distal tail protein Dit | - |
| KPG64_RS01965 (KPG64_01965) | - | 341016..345866 (+) | 4851 | WP_062804252.1 | phage tail spike protein | - |
| KPG64_RS01970 (KPG64_01970) | - | 345883..346260 (+) | 378 | WP_000354139.1 | hypothetical protein | - |
| KPG64_RS01975 (KPG64_01975) | - | 346362..347321 (+) | 960 | WP_042597018.1 | site-specific integrase | - |
| KPG64_RS01980 (KPG64_01980) | - | 347336..347617 (+) | 282 | WP_042597020.1 | hypothetical protein | - |
| KPG64_RS01985 (KPG64_01985) | - | 347620..347826 (+) | 207 | WP_000159646.1 | hypothetical protein | - |
| KPG64_RS01990 (KPG64_01990) | - | 347826..348644 (+) | 819 | WP_042597022.1 | GH25 family lysozyme | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10070.68 Da Isoelectric Point: 7.1683
>NTDB_id=576318 KPG64_RS01770 WP_042596968.1 313563..313841(+) (abrB) [Bacillus thuringiensis strain GR007]
MKDTGVTRKVDELGRVVIPVELRRTLGIAEGTALDFHVDGENIVLRKPEKSCLVTGEVSESNMEFFGGRMFLSKAGAKEL
LNALEKSVKVHA
MKDTGVTRKVDELGRVVIPVELRRTLGIAEGTALDFHVDGENIVLRKPEKSCLVTGEVSESNMEFFGGRMFLSKAGAKEL
LNALEKSVKVHA
Nucleotide
Download Length: 279 bp
>NTDB_id=576318 KPG64_RS01770 WP_042596968.1 313563..313841(+) (abrB) [Bacillus thuringiensis strain GR007]
ATGAAAGACACAGGCGTTACAAGAAAAGTAGACGAGCTAGGTCGTGTGGTAATTCCGGTAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGGACAGCACTAGACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACCAGAAAAATCATGCTTGG
TGACGGGGGAAGTTTCTGAATCGAACATGGAATTTTTTGGCGGTAGAATGTTTTTGAGTAAGGCAGGAGCAAAAGAATTA
CTTAATGCTCTTGAAAAGAGTGTGAAGGTACATGCCTAA
ATGAAAGACACAGGCGTTACAAGAAAAGTAGACGAGCTAGGTCGTGTGGTAATTCCGGTAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGGACAGCACTAGACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACCAGAAAAATCATGCTTGG
TGACGGGGGAAGTTTCTGAATCGAACATGGAATTTTTTGGCGGTAGAATGTTTTTGAGTAAGGCAGGAGCAAAAGAATTA
CTTAATGCTCTTGAAAAGAGTGTGAAGGTACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
54.945 |
98.913 |
0.543 |