Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG75_RS00730 Genome accession   NZ_CP094144
Coordinates   151741..151866 (+) Length   41 a.a.
NCBI ID   WP_120902658.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe029     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 146741..156866
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG75_RS00705 (MPG75_00705) - 146803..149025 (+) 2223 WP_245039416.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG75_RS00710 (MPG75_00710) panD 149015..149365 (+) 351 WP_231207590.1 aspartate 1-decarboxylase -
  MPG75_RS00715 (MPG75_00715) - 149376..149669 (+) 294 WP_245039417.1 YbaB/EbfC family nucleoid-associated protein -
  MPG75_RS00720 (MPG75_00720) - 149669..150664 (+) 996 WP_245040062.1 PDZ domain-containing protein -
  MPG75_RS00725 (MPG75_00725) comB6 150670..151725 (+) 1056 WP_245040063.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG75_RS00730 (MPG75_00730) comB7 151741..151866 (+) 126 WP_120902658.1 comB7 lipoprotein Machinery gene
  MPG75_RS00735 (MPG75_00735) comB8 151863..152606 (+) 744 WP_245039418.1 virB8 family protein Machinery gene
  MPG75_RS00740 (MPG75_00740) comB9 152606..153568 (+) 963 WP_245039419.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG75_RS00745 (MPG75_00745) comB10 153561..154697 (+) 1137 WP_245039421.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG75_RS00750 (MPG75_00750) - 154767..156179 (+) 1413 WP_245039423.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4812.85 Da        Isoelectric Point: 9.3278

>NTDB_id=576191 MPG75_RS00730 WP_120902658.1 151741..151866(+) (comB7) [Helicobacter pylori strain Hpfe029]
MRIFFVIMGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=576191 MPG75_RS00730 WP_120902658.1 151741..151866(+) (comB7) [Helicobacter pylori strain Hpfe029]
ATGAGAATTTTTTTTGTCATTATGGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAAATGAAAAAAAGCCCCTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854