Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG50_RS00700 Genome accession   NZ_CP094134
Coordinates   150154..150267 (+) Length   37 a.a.
NCBI ID   WP_073422943.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe048     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 145154..155267
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG50_RS00675 (MPG50_00675) - 145214..147436 (+) 2223 WP_245032364.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG50_RS00680 (MPG50_00680) panD 147426..147776 (+) 351 WP_000142212.1 aspartate 1-decarboxylase -
  MPG50_RS00685 (MPG50_00685) - 147787..148080 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG50_RS00690 (MPG50_00690) - 148080..149075 (+) 996 WP_245033084.1 PDZ domain-containing protein -
  MPG50_RS00695 (MPG50_00695) comB6 149083..150138 (+) 1056 WP_245033086.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG50_RS00700 (MPG50_00700) comB7 150154..150267 (+) 114 WP_073422943.1 comB7 lipoprotein Machinery gene
  MPG50_RS00705 (MPG50_00705) comB8 150264..151007 (+) 744 WP_245032366.1 virB8 family protein Machinery gene
  MPG50_RS00710 (MPG50_00710) comB9 151007..151972 (+) 966 WP_245032368.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG50_RS00715 (MPG50_00715) comB10 151965..153101 (+) 1137 WP_245032370.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG50_RS00720 (MPG50_00720) - 153171..154583 (+) 1413 WP_245032372.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4287.23 Da        Isoelectric Point: 9.3572

>NTDB_id=575835 MPG50_RS00700 WP_073422943.1 150154..150267(+) (comB7) [Helicobacter pylori strain Hpfe048]
MRIFFVIIGLILFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=575835 MPG50_RS00700 WP_073422943.1 150154..150267(+) (comB7) [Helicobacter pylori strain Hpfe048]
ATGAGAATTTTTTTTGTTATTATTGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919