Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   KOM05_RS11700 Genome accession   NZ_CP076414
Coordinates   2439821..2440135 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain NJ13     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2434821..2445135
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KOM05_RS11655 (KOM05_11560) sinI 2435502..2435675 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  KOM05_RS11660 (KOM05_11565) sinR 2435709..2436044 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KOM05_RS11665 (KOM05_11570) tasA 2436092..2436877 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  KOM05_RS11670 (KOM05_11575) sipW 2436942..2437526 (-) 585 WP_032874025.1 signal peptidase I SipW -
  KOM05_RS11675 (KOM05_11580) tapA 2437498..2438169 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  KOM05_RS11680 (KOM05_11585) - 2438428..2438757 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  KOM05_RS11685 (KOM05_11590) - 2438798..2438977 (-) 180 WP_022552966.1 YqzE family protein -
  KOM05_RS11690 (KOM05_11595) comGG 2439034..2439411 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  KOM05_RS11695 (KOM05_11600) comGF 2439412..2439912 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  KOM05_RS11700 (KOM05_11605) comGE 2439821..2440135 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  KOM05_RS11705 (KOM05_11610) comGD 2440119..2440556 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  KOM05_RS11710 (KOM05_11615) comGC 2440546..2440854 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  KOM05_RS11715 (KOM05_11620) comGB 2440859..2441896 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  KOM05_RS11720 (KOM05_11625) comGA 2441883..2442953 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  KOM05_RS11725 (KOM05_11630) - 2443150..2444100 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=575237 KOM05_RS11700 WP_032874016.1 2439821..2440135(-) (comGE) [Bacillus velezensis strain NJ13]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=575237 KOM05_RS11700 WP_032874016.1 2439821..2440135(-) (comGE) [Bacillus velezensis strain NJ13]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481