Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG80_RS00705 Genome accession   NZ_CP094115
Coordinates   153615..153740 (+) Length   41 a.a.
NCBI ID   WP_180393507.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe068     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 148615..158740
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG80_RS00680 (MPG80_00680) - 148677..150899 (+) 2223 WP_245055678.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG80_RS00685 (MPG80_00685) panD 150889..151239 (+) 351 WP_245055680.1 aspartate 1-decarboxylase -
  MPG80_RS00690 (MPG80_00690) - 151250..151543 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG80_RS00695 (MPG80_00695) - 151543..152538 (+) 996 WP_245056272.1 PDZ domain-containing protein -
  MPG80_RS00700 (MPG80_00700) comB6 152544..153599 (+) 1056 WP_245055682.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG80_RS00705 (MPG80_00705) comB7 153615..153740 (+) 126 WP_180393507.1 comB7 lipoprotein Machinery gene
  MPG80_RS00710 (MPG80_00710) comB8 153737..154480 (+) 744 WP_000660524.1 virB8 family protein Machinery gene
  MPG80_RS00715 (MPG80_00715) comB9 154480..155442 (+) 963 WP_245055684.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG80_RS00720 (MPG80_00720) comB10 155435..156571 (+) 1137 WP_245055686.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG80_RS00725 (MPG80_00725) - 156641..158053 (+) 1413 WP_245055688.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4770.78 Da        Isoelectric Point: 9.3278

>NTDB_id=575233 MPG80_RS00705 WP_180393507.1 153615..153740(+) (comB7) [Helicobacter pylori strain Hpfe068]
MRIFSVIMGLMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=575233 MPG80_RS00705 WP_180393507.1 153615..153740(+) (comB7) [Helicobacter pylori strain Hpfe068]
ATGAGAATTTTTTCTGTTATTATGGGACTAATGTTGTTTGGTTGCACCAGTAAAGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829