Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   ZHX2020_RS02215 Genome accession   NZ_CP076409
Coordinates   379800..380210 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus sp. ZHX3     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 375167..409953 379800..380210 within 0


Gene organization within MGE regions


Location: 375167..409953
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ZHX2020_RS02190 (ZHX2020_02190) - 375334..376065 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  ZHX2020_RS02195 (ZHX2020_02195) cwlH 376317..377069 (-) 753 WP_014480318.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  ZHX2020_RS02200 (ZHX2020_02200) - 377256..377882 (+) 627 WP_014480319.1 TVP38/TMEM64 family protein -
  ZHX2020_RS02205 (ZHX2020_02205) gnd 377901..378794 (-) 894 WP_014480320.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  ZHX2020_RS02210 (ZHX2020_02210) - 379045..379767 (+) 723 WP_014480321.1 hypothetical protein -
  ZHX2020_RS02215 (ZHX2020_02215) nucA/comI 379800..380210 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  ZHX2020_RS02220 (ZHX2020_02220) sigK 380406..381134 (+) 729 WP_013308023.1 RNA polymerase sporulation sigma factor SigK -
  ZHX2020_RS02225 (ZHX2020_02225) - 381134..381232 (+) 99 WP_031600702.1 hypothetical protein -
  ZHX2020_RS02230 - 381229..381441 (-) 213 Protein_443 recombinase family protein -
  ZHX2020_RS02235 (ZHX2020_02235) fumC 381660..383048 (-) 1389 WP_014480325.1 class II fumarate hydratase -
  ZHX2020_RS02240 (ZHX2020_02240) - 383215..384105 (+) 891 WP_014480326.1 LysR family transcriptional regulator -
  ZHX2020_RS02245 (ZHX2020_02245) - 385047..385442 (+) 396 WP_014480327.1 VOC family protein -
  ZHX2020_RS02255 (ZHX2020_02250) - 386182..387309 (-) 1128 WP_014480328.1 Rap family tetratricopeptide repeat protein -
  ZHX2020_RS22525 (ZHX2020_02255) - 387491..389417 (+) 1927 Protein_448 T7SS effector LXG polymorphic toxin -
  ZHX2020_RS02270 (ZHX2020_02260) - 389431..389718 (+) 288 WP_014480331.1 hypothetical protein -
  ZHX2020_RS02275 (ZHX2020_02265) - 390121..390561 (+) 441 WP_014480332.1 SMI1/KNR4 family protein -
  ZHX2020_RS02280 (ZHX2020_02270) - 390660..391112 (+) 453 WP_014480333.1 SMI1/KNR4 family protein -
  ZHX2020_RS02285 (ZHX2020_02275) cdiI 391209..391568 (+) 360 WP_014480334.1 ribonuclease toxin immunity protein CdiI -
  ZHX2020_RS02290 (ZHX2020_02280) - 391640..392152 (+) 513 WP_014477426.1 hypothetical protein -
  ZHX2020_RS02295 (ZHX2020_02285) - 392460..392663 (-) 204 WP_123772462.1 hypothetical protein -
  ZHX2020_RS02300 (ZHX2020_02290) - 392752..392985 (+) 234 WP_224588641.1 hypothetical protein -
  ZHX2020_RS02305 (ZHX2020_02295) - 393253..393830 (+) 578 Protein_456 suppressor of fused domain protein -
  ZHX2020_RS02310 (ZHX2020_02300) - 393940..394230 (+) 291 WP_014480337.1 contact-dependent growth inhibition system immunity protein -
  ZHX2020_RS02315 (ZHX2020_02305) istA 395071..396616 (+) 1546 Protein_458 IS21 family transposase -
  ZHX2020_RS02320 (ZHX2020_02310) istB 396613..397371 (+) 759 WP_014479891.1 IS21-like element helper ATPase IstB -
  ZHX2020_RS02325 - 397689..397786 (-) 98 Protein_460 N-acetylmuramoyl-L-alanine amidase -
  ZHX2020_RS02330 (ZHX2020_02320) - 397991..398050 (+) 60 WP_076458313.1 putative holin-like toxin -
  ZHX2020_RS02335 - 398337..398549 (-) 213 WP_306136174.1 phage tail tube protein -
  ZHX2020_RS02340 - 398576..398755 (-) 180 Protein_463 phage tail tube protein -
  ZHX2020_RS02345 (ZHX2020_02330) terS 398771..399336 (-) 566 Protein_464 phage terminase small subunit -
  ZHX2020_RS02350 (ZHX2020_02335) - 399463..399768 (+) 306 WP_123772463.1 hypothetical protein -
  ZHX2020_RS02355 - 399941..400006 (-) 66 Protein_466 hypothetical protein -
  ZHX2020_RS02360 (ZHX2020_02340) - 400161..400640 (-) 480 WP_014480344.1 hypothetical protein -
  ZHX2020_RS02365 (ZHX2020_02345) - 401257..401523 (+) 267 WP_033881358.1 hypothetical protein -
  ZHX2020_RS02370 (ZHX2020_02350) - 401662..401814 (-) 153 WP_049832653.1 XtrA/YqaO family protein -
  ZHX2020_RS02375 (ZHX2020_02355) - 401897..402019 (-) 123 Protein_470 RusA family crossover junction endodeoxyribonuclease -
  ZHX2020_RS02380 (ZHX2020_02360) - 401982..402230 (-) 249 Protein_471 hypothetical protein -
  ZHX2020_RS02385 - 402375..402605 (-) 231 WP_224588644.1 hypothetical protein -
  ZHX2020_RS02390 (ZHX2020_02370) - 402914..403094 (-) 181 Protein_473 hypothetical protein -
  ZHX2020_RS02395 (ZHX2020_02375) bltR 403302..404123 (-) 822 WP_014480349.1 multidrug efflux transcriptional regulator BltR -
  ZHX2020_RS02400 (ZHX2020_02380) blt 404240..405442 (+) 1203 WP_014480350.1 multidrug efflux MFS transporter Blt -
  ZHX2020_RS02405 (ZHX2020_02385) bltD 405624..406082 (+) 459 WP_014480351.1 spermine/spermidine acetyltransferase -
  ZHX2020_RS02410 (ZHX2020_02390) - 406241..407545 (-) 1305 WP_014480352.1 hemolysin family protein -
  ZHX2020_RS02415 (ZHX2020_02395) - 407835..407978 (-) 144 WP_014477437.1 YrzO family protein -
  ZHX2020_RS02420 (ZHX2020_02400) - 407996..408961 (-) 966 WP_014480354.1 DMT family transporter -
  ZHX2020_RS02425 (ZHX2020_02405) czcR 409087..409953 (+) 867 WP_014480355.1 LysR family transcriptional regulator CzcR -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=575112 ZHX2020_RS02215 WP_009967785.1 379800..380210(-) (nucA/comI) [Bacillus sp. ZHX3]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=575112 ZHX2020_RS02215 WP_009967785.1 379800..380210(-) (nucA/comI) [Bacillus sp. ZHX3]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529