Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG69_RS00710 Genome accession   NZ_CP094096
Coordinates   150565..150690 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe082     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 145565..155690
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG69_RS00685 (MPG69_00685) - 145627..147849 (+) 2223 WP_245056012.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG69_RS00690 (MPG69_00690) panD 147839..148189 (+) 351 WP_000142212.1 aspartate 1-decarboxylase -
  MPG69_RS00695 (MPG69_00695) - 148200..148493 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG69_RS00700 (MPG69_00700) - 148493..149488 (+) 996 WP_245056706.1 PDZ domain-containing protein -
  MPG69_RS00705 (MPG69_00705) comB6 149494..150549 (+) 1056 WP_245056708.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG69_RS00710 (MPG69_00710) comB7 150565..150690 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG69_RS00715 (MPG69_00715) comB8 150687..151430 (+) 744 WP_000660533.1 virB8 family protein Machinery gene
  MPG69_RS00720 (MPG69_00720) comB9 151430..152392 (+) 963 WP_180506423.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG69_RS00725 (MPG69_00725) comB10 152385..153521 (+) 1137 WP_245056015.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG69_RS00730 (MPG69_00730) - 153587..154999 (+) 1413 WP_245056017.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=574745 MPG69_RS00710 WP_001217874.1 150565..150690(+) (comB7) [Helicobacter pylori strain Hpfe082]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=574745 MPG69_RS00710 WP_001217874.1 150565..150690(+) (comB7) [Helicobacter pylori strain Hpfe082]
ATGAGAATTTTTTTTGTTATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCCTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878