Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPF97_RS00705 Genome accession   NZ_CP094093
Coordinates   151771..151884 (+) Length   37 a.a.
NCBI ID   WP_245102614.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe085     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 146771..156884
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPF97_RS00680 (MPF97_00680) - 146833..149055 (+) 2223 WP_245102610.1 ATP-dependent Clp protease ATP-binding subunit -
  MPF97_RS00685 (MPF97_00685) panD 149045..149395 (+) 351 WP_245102612.1 aspartate 1-decarboxylase -
  MPF97_RS00690 (MPF97_00690) - 149406..149699 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPF97_RS00695 (MPF97_00695) - 149699..150694 (+) 996 WP_245103197.1 PDZ domain-containing protein -
  MPF97_RS00700 (MPF97_00700) comB6 150700..151755 (+) 1056 WP_154443589.1 P-type conjugative transfer protein TrbL Machinery gene
  MPF97_RS00705 (MPF97_00705) comB7 151771..151884 (+) 114 WP_245102614.1 comB7 lipoprotein Machinery gene
  MPF97_RS00710 (MPF97_00710) comB8 151881..152624 (+) 744 WP_015429416.1 virB8 family protein Machinery gene
  MPF97_RS00715 (MPF97_00715) comB9 152624..153586 (+) 963 WP_245102616.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPF97_RS00720 (MPF97_00720) comB10 153579..154715 (+) 1137 WP_245102618.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPF97_RS00725 (MPF97_00725) - 154785..156197 (+) 1413 WP_245102620.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4277.21 Da        Isoelectric Point: 9.3572

>NTDB_id=574623 MPF97_RS00705 WP_245102614.1 151771..151884(+) (comB7) [Helicobacter pylori strain Hpfe085]
MRIFFAIMGLILFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=574623 MPF97_RS00705 WP_245102614.1 151771..151884(+) (comB7) [Helicobacter pylori strain Hpfe085]
ATGAGAATTTTTTTTGCCATTATGGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919