Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG82_RS00725 Genome accession   NZ_CP094092
Coordinates   152145..152258 (+) Length   37 a.a.
NCBI ID   WP_001218100.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe086     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 147145..157258
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG82_RS00700 (MPG82_00700) - 147205..149427 (+) 2223 WP_245082760.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG82_RS00705 (MPG82_00705) panD 149417..149767 (+) 351 WP_245082763.1 aspartate 1-decarboxylase -
  MPG82_RS00710 (MPG82_00710) - 149778..150071 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG82_RS00715 (MPG82_00715) - 150071..151066 (+) 996 WP_245083601.1 PDZ domain-containing protein -
  MPG82_RS00720 (MPG82_00720) comB6 151074..152129 (+) 1056 WP_245083602.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG82_RS00725 (MPG82_00725) comB7 152145..152258 (+) 114 WP_001218100.1 hypothetical protein Machinery gene
  MPG82_RS00730 (MPG82_00730) comB8 152255..152998 (+) 744 WP_000660524.1 virB8 family protein Machinery gene
  MPG82_RS00735 (MPG82_00735) comB9 152998..153960 (+) 963 WP_245082766.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG82_RS00740 (MPG82_00740) comB10 153953..155089 (+) 1137 WP_245082769.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG82_RS00745 (MPG82_00745) - 155159..156571 (+) 1413 WP_245082773.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4263.19 Da        Isoelectric Point: 9.3572

>NTDB_id=574583 MPG82_RS00725 WP_001218100.1 152145..152258(+) (comB7) [Helicobacter pylori strain Hpfe086]
MRIFSVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=574583 MPG82_RS00725 WP_001218100.1 152145..152258(+) (comB7) [Helicobacter pylori strain Hpfe086]
ATGAGAATTTTTTCTGTCATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

89.189

100

0.892