Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG64_RS00795 Genome accession   NZ_CP094085
Coordinates   167373..167498 (+) Length   41 a.a.
NCBI ID   WP_021307643.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe095     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 162373..172498
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG64_RS00770 (MPG64_00770) - 162436..164655 (+) 2220 WP_245076411.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG64_RS00775 (MPG64_00775) panD 164645..164995 (+) 351 WP_156608295.1 aspartate 1-decarboxylase -
  MPG64_RS00780 (MPG64_00780) - 165006..165299 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG64_RS00785 (MPG64_00785) - 165299..166294 (+) 996 WP_245077031.1 PDZ domain-containing protein -
  MPG64_RS00790 (MPG64_00790) comB6 166302..167357 (+) 1056 WP_180419650.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG64_RS00795 (MPG64_00795) comB7 167373..167498 (+) 126 WP_021307643.1 hypothetical protein Machinery gene
  MPG64_RS00800 (MPG64_00800) comB8 167495..168238 (+) 744 WP_000660524.1 virB8 family protein Machinery gene
  MPG64_RS00805 (MPG64_00805) comB9 168238..169200 (+) 963 WP_245076413.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG64_RS00810 (MPG64_00810) comB10 169193..170329 (+) 1137 WP_245076415.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG64_RS00815 (MPG64_00815) - 170395..171810 (+) 1416 WP_245076417.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4780.79 Da        Isoelectric Point: 9.3278

>NTDB_id=574385 MPG64_RS00795 WP_021307643.1 167373..167498(+) (comB7) [Helicobacter pylori strain Hpfe095]
MRIFFVIMGLVLFGCTSKVHEIKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=574385 MPG64_RS00795 WP_021307643.1 167373..167498(+) (comB7) [Helicobacter pylori strain Hpfe095]
ATGAGAATTTTTTTTGTTATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATAAAAAAAAGCCCCTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854