Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   A7A21_RS05290 Genome accession   NZ_CP076276
Coordinates   1111756..1112385 (+) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain SA31-1     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1098757..1133965 1111756..1112385 within 0


Gene organization within MGE regions


Location: 1098757..1133965
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A7A21_RS05240 (A7A21_05210) uup 1100582..1102489 (+) 1908 WP_000053089.1 ABC transporter ATP-binding protein -
  A7A21_RS05245 (A7A21_05215) pqiA 1102619..1103872 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  A7A21_RS05250 (A7A21_05220) pqiB 1103877..1105517 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  A7A21_RS05255 (A7A21_05225) pqiC 1105514..1106077 (+) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  A7A21_RS05260 (A7A21_05230) rmf 1106333..1106500 (+) 168 WP_000828648.1 ribosome modulation factor -
  A7A21_RS05265 (A7A21_05235) fabA 1106570..1107088 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  A7A21_RS05270 (A7A21_05240) ycbZ 1107157..1108917 (-) 1761 WP_000156526.1 Lon protease family protein -
  A7A21_RS05275 (A7A21_05245) matP 1109103..1109555 (+) 453 WP_000877161.1 macrodomain Ter protein MatP -
  A7A21_RS05280 (A7A21_05250) ompA 1109631..1110671 (-) 1041 WP_000750416.1 porin OmpA -
  A7A21_RS05285 (A7A21_05255) sulA 1111028..1111537 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  A7A21_RS05290 (A7A21_05260) sxy/tfoX 1111756..1112385 (+) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  A7A21_RS05295 (A7A21_05265) yccS 1112348..1114510 (-) 2163 WP_257114875.1 YccS family putative transporter -
  A7A21_RS05300 (A7A21_05270) yccF 1114520..1114966 (-) 447 WP_001261235.1 YccF domain-containing protein -
  A7A21_RS05305 (A7A21_05275) helD 1115089..1117143 (+) 2055 WP_257114876.1 DNA helicase IV -
  A7A21_RS05310 (A7A21_05280) mgsA 1117175..1117633 (-) 459 WP_000424181.1 methylglyoxal synthase -
  A7A21_RS05315 (A7A21_05285) yccT 1117729..1118391 (-) 663 WP_000847791.1 DUF2057 family protein -
  A7A21_RS05320 (A7A21_05290) yccU 1118564..1118977 (+) 414 WP_000665217.1 CoA-binding protein -
  A7A21_RS05325 (A7A21_05295) hspQ 1119022..1119339 (-) 318 WP_001295356.1 heat shock protein HspQ -
  A7A21_RS05330 (A7A21_05300) rlmI 1119397..1120587 (-) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  A7A21_RS05335 (A7A21_05305) yccX 1120682..1120960 (+) 279 WP_000048250.1 acylphosphatase -
  A7A21_RS05340 (A7A21_05310) tusE 1120957..1121286 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  A7A21_RS05345 (A7A21_05315) yccA 1121377..1122036 (-) 660 WP_000375136.1 FtsH protease modulator YccA -
  A7A21_RS05350 (A7A21_05320) - 1122444..1123463 (-) 1020 WP_161620353.1 tyrosine-type recombinase/integrase -
  A7A21_RS05355 (A7A21_05325) - 1123432..1123683 (-) 252 WP_000273158.1 DUF4224 domain-containing protein -
  A7A21_RS05360 (A7A21_05330) - 1123750..1126221 (-) 2472 WP_257114877.1 exonuclease -
  A7A21_RS05365 (A7A21_05335) - 1126302..1126505 (-) 204 WP_001090193.1 DUF1482 family protein -
  A7A21_RS05370 (A7A21_05340) dicB 1126502..1126690 (-) 189 WP_000449183.1 cell division inhibition protein DicB -
  A7A21_RS05375 (A7A21_05345) - 1127258..1127491 (+) 234 WP_257114878.1 hypothetical protein -
  A7A21_RS05380 (A7A21_05350) - 1127469..1127876 (-) 408 WP_257114879.1 hypothetical protein -
  A7A21_RS05385 (A7A21_05355) ydfC 1127899..1128117 (-) 219 WP_086590109.1 protein YdfC -
  A7A21_RS25205 ydfB 1128147..1128275 (-) 129 Protein_1057 protein YdfB -
  A7A21_RS05390 (A7A21_05360) ydfA 1128277..1128432 (-) 156 WP_000379577.1 DUF1391 family protein -
  A7A21_RS05395 (A7A21_05365) - 1128622..1129029 (-) 408 WP_257114881.1 helix-turn-helix domain-containing protein -
  A7A21_RS05400 (A7A21_05370) - 1129108..1129335 (+) 228 WP_096836088.1 Cro/CI family transcriptional regulator -
  A7A21_RS05405 (A7A21_05375) - 1129319..1129870 (+) 552 WP_096836086.1 toxin YdaT family protein -
  A7A21_RS05410 (A7A21_05380) - 1129842..1130882 (+) 1041 WP_257114883.1 DnaT-like ssDNA-binding domain-containing protein -
  A7A21_RS05415 (A7A21_05385) - 1130875..1131336 (+) 462 WP_244577064.1 replication protein P -
  A7A21_RS05420 (A7A21_05390) - 1131371..1132132 (+) 762 WP_122996659.1 DUF1627 domain-containing protein -
  A7A21_RS05425 (A7A21_05395) - 1132149..1132571 (+) 423 WP_096836080.1 DUF977 family protein -
  A7A21_RS05430 (A7A21_05400) - 1132629..1132985 (+) 357 WP_040072812.1 hypothetical protein -
  A7A21_RS05435 (A7A21_05405) - 1133036..1133236 (+) 201 WP_257114884.1 hypothetical protein -
  A7A21_RS05440 (A7A21_05410) - 1133281..1133499 (+) 219 WP_096836078.1 DUF4014 family protein -
  A7A21_RS05445 (A7A21_05415) - 1133501..1133866 (+) 366 WP_001229296.1 HNH endonuclease -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=574299 A7A21_RS05290 WP_000839153.1 1111756..1112385(+) (sxy/tfoX) [Escherichia coli strain SA31-1]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=574299 A7A21_RS05290 WP_000839153.1 1111756..1112385(+) (sxy/tfoX) [Escherichia coli strain SA31-1]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1