Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   A7A10_RS05130 Genome accession   NZ_CP076274
Coordinates   1085672..1086301 (+) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain P393-F10     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1072662..1107882 1085672..1086301 within 0


Gene organization within MGE regions


Location: 1072662..1107882
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A7A10_RS05080 (A7A10_05070) uup 1074487..1076394 (+) 1908 WP_000053120.1 ABC transporter ATP-binding protein -
  A7A10_RS05085 (A7A10_05075) pqiA 1076524..1077777 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  A7A10_RS05090 (A7A10_05080) pqiB 1077782..1079422 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  A7A10_RS05095 (A7A10_05085) pqiC 1079419..1079982 (+) 564 WP_000759129.1 membrane integrity-associated transporter subunit PqiC -
  A7A10_RS05100 (A7A10_05090) rmf 1080238..1080405 (+) 168 WP_000828648.1 ribosome modulation factor -
  A7A10_RS05105 (A7A10_05095) fabA 1080475..1080993 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  A7A10_RS05110 (A7A10_05100) ycbZ 1081062..1082822 (-) 1761 WP_000156526.1 Lon protease family protein -
  A7A10_RS05115 (A7A10_05105) matP 1083008..1083460 (+) 453 WP_000877158.1 macrodomain Ter protein MatP -
  A7A10_RS05120 (A7A10_05110) ompA 1083535..1084587 (-) 1053 WP_000750419.1 porin OmpA -
  A7A10_RS05125 (A7A10_05115) sulA 1084944..1085453 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  A7A10_RS05130 (A7A10_05120) sxy/tfoX 1085672..1086301 (+) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  A7A10_RS05135 (A7A10_05125) yccS 1086264..1088426 (-) 2163 WP_000875044.1 YccS family putative transporter -
  A7A10_RS05140 (A7A10_05130) yccF 1088436..1088882 (-) 447 WP_001261235.1 YccF domain-containing protein -
  A7A10_RS05145 (A7A10_05135) helD 1089005..1091059 (+) 2055 WP_001315388.1 DNA helicase IV -
  A7A10_RS05150 (A7A10_05140) mgsA 1091091..1091549 (-) 459 WP_000424181.1 methylglyoxal synthase -
  A7A10_RS05155 (A7A10_05145) yccT 1091645..1092307 (-) 663 WP_000847791.1 DUF2057 family protein -
  A7A10_RS05160 (A7A10_05150) yccU 1092480..1092893 (+) 414 WP_000665217.1 CoA-binding protein -
  A7A10_RS05165 (A7A10_05155) hspQ 1092938..1093255 (-) 318 WP_001295356.1 heat shock protein HspQ -
  A7A10_RS05170 (A7A10_05160) rlmI 1093313..1094503 (-) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  A7A10_RS05175 (A7A10_05165) yccX 1094598..1094876 (+) 279 WP_000048250.1 acylphosphatase -
  A7A10_RS05180 (A7A10_05170) tusE 1094873..1095202 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  A7A10_RS05185 (A7A10_05175) yccA 1095293..1095952 (-) 660 WP_000375136.1 FtsH protease modulator YccA -
  A7A10_RS05190 (A7A10_05180) - 1096360..1097379 (-) 1020 WP_161620353.1 tyrosine-type recombinase/integrase -
  A7A10_RS05195 (A7A10_05185) - 1097348..1097599 (-) 252 WP_000273158.1 DUF4224 domain-containing protein -
  A7A10_RS05200 (A7A10_05190) - 1097666..1100137 (-) 2472 WP_257185829.1 exonuclease -
  A7A10_RS05205 (A7A10_05195) - 1100231..1100422 (-) 192 WP_032083069.1 DUF1482 family protein -
  A7A10_RS05210 (A7A10_05200) dicB 1100419..1100607 (-) 189 WP_032083068.1 cell division inhibition protein DicB -
  A7A10_RS05215 (A7A10_05205) - 1101175..1101408 (+) 234 WP_096836093.1 hypothetical protein -
  A7A10_RS05220 (A7A10_05210) - 1101386..1101793 (-) 408 WP_096836091.1 hypothetical protein -
  A7A10_RS05225 (A7A10_05215) ydfC 1101816..1102034 (-) 219 WP_096934465.1 protein YdfC -
  A7A10_RS26055 ydfB 1102064..1102192 (-) 129 Protein_1027 protein YdfB -
  A7A10_RS05230 (A7A10_05220) ydfA 1102194..1102349 (-) 156 WP_000379577.1 DUF1391 family protein -
  A7A10_RS05235 (A7A10_05225) - 1102539..1102946 (-) 408 WP_052924627.1 helix-turn-helix domain-containing protein -
  A7A10_RS05240 (A7A10_05230) - 1103025..1103252 (+) 228 WP_096836088.1 Cro/CI family transcriptional regulator -
  A7A10_RS05245 (A7A10_05235) - 1103236..1103787 (+) 552 WP_096836086.1 toxin YdaT family protein -
  A7A10_RS05250 (A7A10_05240) - 1103759..1104799 (+) 1041 WP_122996405.1 DnaT-like ssDNA-binding domain-containing protein -
  A7A10_RS05255 (A7A10_05245) - 1104792..1105253 (+) 462 WP_244577064.1 replication protein P -
  A7A10_RS05260 (A7A10_05250) - 1105288..1106049 (+) 762 WP_257185830.1 DUF1627 domain-containing protein -
  A7A10_RS05265 (A7A10_05255) - 1106066..1106488 (+) 423 WP_096836080.1 DUF977 family protein -
  A7A10_RS05270 (A7A10_05260) - 1106546..1106902 (+) 357 WP_257185929.1 hypothetical protein -
  A7A10_RS05275 (A7A10_05265) - 1106953..1107165 (+) 213 WP_040072799.1 hypothetical protein -
  A7A10_RS05280 (A7A10_05270) - 1107198..1107416 (+) 219 WP_096836078.1 DUF4014 family protein -
  A7A10_RS05285 (A7A10_05275) - 1107418..1107783 (+) 366 WP_001229296.1 HNH endonuclease -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=574277 A7A10_RS05130 WP_000839153.1 1085672..1086301(+) (sxy/tfoX) [Escherichia coli strain P393-F10]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=574277 A7A10_RS05130 WP_000839153.1 1085672..1086301(+) (sxy/tfoX) [Escherichia coli strain P393-F10]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1